KEGG   Bacillus subtilis subsp. subtilis 168: BSU02610
Entry
BSU02610          CDS       T00010                                 

Symbol
ycbR
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: vWA-TerF-like Copine
Other DBs
NCBI-GeneID: 938394
NCBI-ProteinID: NP_388143
Pasteur: BG11173
BSORF: BG11173
UniProt: P42250 A0A6M3ZA80
Position
283003..283734
AA seq 243 aa
MATIDLQKKSVKIVLEKKQLTKVTARVGLVLDITGSMRPLYKNGTVQNVVERILAVADQF
DDNGLLDVWVYDNEFSRLKPVSEKDFSGYVDREILNNDRLHKFGRNDEPPVMKDVLRKYV
TEEPSSYPAFIVFINDGGCKKSIKPIIEASSDKPVFWQFVGIGNGNFDFLNKLDTLEGRV
IDNTNFLHIEEIDRISDDELYDALLAEFPFWLKEAKEKGIVREQEPPAEKPKKKGFFSRL
FSK
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcaacaattgacctgcaaaagaaaagtgtaaagatcgtactggagaaaaagcagtta
acgaaggtgacggctcgtgttggactggttcttgatattacgggatcgatgagaccgctc
tacaaaaacgggacggttcaaaatgtggtggagcggattttggcagtggctgatcagttt
gatgataacggtttgctggatgtatgggtgtatgataatgaattttcccgattaaagcca
gtttcagaaaaggatttttcgggctatgtcgatcgtgaaattttaaataatgaccgcttg
cataaattcggcagaaatgatgagccgccagtcatgaaggacgtgctgcgcaaatatgtt
acggaggaaccgagctcgtatcctgctttcattgtttttatcaatgacgggggctgtaaa
aagtcaatcaaaccgataattgaagcttcttctgataaaccggtgttctggcagtttgtc
ggcatcggaaacggaaactttgattttctcaataaactggatacgttagaagggcgtgtc
attgataacacgaacttcctgcatatcgaagagattgaccgcatttctgatgatgagctt
tatgatgctctgcttgctgaatttccattttggctgaaagaagcgaaggaaaaagggatt
gtaagagaacaagagcctcctgctgaaaagccgaaaaagaagggctttttcagcagattg
ttttcgaaataa

DBGET integrated database retrieval system