KEGG   Bacillus subtilis subsp. subtilis 168: BSU02619
Entry
BSU02619          CDS       T00010                                 

Symbol
yczK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8302909
NCBI-ProteinID: YP_003097673
UniProt: C0H3T2 A0A6M4JEV1
Position
283816..283992
AA seq 58 aa
MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLHSRLTMISYNGDDQ
NT seq 177 nt   +upstreamnt  +downstreamnt
atgggcggcttgcaaacgacaggatatgcagaaaacgcgtcattcagccagctttcggca
tgtttcagcagcaggcttgtgagggaagacctgtttttaatgttcagcgcttacaatcag
ttcacacttcttcacagtcgtttaacaatgatttcctataatggagacgatcaatga

DBGET integrated database retrieval system