KEGG   Bacillus subtilis subsp. subtilis 168: BSU02620
Entry
BSU02620          CDS       T00010                                 

Symbol
phoD
Name
(RefSeq) alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu02020  Two-component system
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU02620 (phoD)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02620 (phoD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSU02620 (phoD)
SSDB
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Other DBs
NCBI-GeneID: 938391
NCBI-ProteinID: NP_388144
Pasteur: BG11174
BSORF: BG11174
UniProt: P42251 A0A6M4JFQ0
Structure
Position
284011..285762
AA seq 583 aa
MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTIAQSVGAFEVNAAPNF
SSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKWEVAKDEHFRKIVRKGT
EMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTLPAPGANVPQMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHNSAEIITLQDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRT
LLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGADKRADTD
QILKENPHIQFFNDYRGYVRCTVTPHQWKADYRVMPFVTEPGAAISTRASFVYQKDQTGL
RKVSSTTIQGGVKQSDEVEEDRFFSHNKAHEKQMIKKRAKITN
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcatacgacagtcgttttgatgaatgggtacagaaactgaaagaggaaagctttcaa
aacaatacgtttgaccgccgcaaatttattcaaggagcggggaagattgcaggactttct
cttggattaacgattgcccagtcggttggggcctttgaagtaaatgctgcgcctaacttc
tcaagctatccgtttacattaggggtagcgtcaggtgatccgctttctgacagtgtcgtg
ctttggacacgtctggcaccagatccgctgaatggcgggggaatgccgaagcaagcagtg
cctgtcaaatgggaggtcgcaaaggatgagcatttccgcaaaatcgtaagaaaaggcact
gaaatggctaaaccaagtcttgcccattccgttcatgtggaagcggacgggcttgagcca
aacaaagtgtactattaccgtttcaaaaccggccatgaactaagccctgtcggaaaaaca
aaaacactgcctgcccctggcgccaatgtgccgcaaatgacctttgcatttgcttcctgc
cagcaatatgagcacggatattatacggcctacaagcatatggcaaaggaaaagcttgat
cttgtcttccatctcggtgattacatatatgaatacggcccaaatgaatatgtatcaaaa
acaggcaatgtccgcacgcacaacagcgcggaaatcattacgctgcaagactatcggaac
cgtcacgctcaataccgttctgacgccaatcttaaagctgcacatgcggcattcccttgg
gttgtaacttgggatgaccatgaagttgaaaacaactatgccaataaaatacctgaaaaa
ggacagtcggttgaagcattcgtgctccgccgcgcggcagcataccaggcatactatgaa
catatgccgctccgcatttcctctttgccgaatggcccagatatgcagctgtaccggcac
tttacgtacggaaacctggcgtccttcaatgtgcttgatacccgccagtacagggacgac
caagccaataacgacggcaataagccgccttctgatgaatcgcgcaatccgaatcggact
ctgcttggaaaagaacaggagcagtggctcttcaacaatttgggcagctcgacagcccac
tggaatgtgctggcgcagcagattttctttgccaagtggaatttcgggacaagcgcaagc
ccgatctacagcatggattcgtgggacggctacccggctcagcgcgaacgggttatcaat
ttcattaaaagcaaaaatctgaataatgttgtcgtactgacaggtgatgtacacgcaagc
tgggcatcgaatttgcatgtcgatttcgagaagacaagttcaaaaatattcggagccgaa
tttgttggaacctcgatcacttccggagggaacggagcggataagcgagcggatacggac
caaattttaaaagaaaatccgcacatccagttctttaacgactatcgcggatatgtccgc
tgtacagtgacgcctcaccagtggaaagccgattatcgggtgatgccatttgtgaccgag
ccgggcgcagccatttccacgcgggcttcattcgtttaccagaaagaccaaaccgggttg
agaaaggtatcatccacaacaatccaaggcggggtgaagcaatccgatgaggtcgaagag
gatcgtttcttttcgcacaacaaagcccacgaaaaacaaatgattaagaagcgtgcaaaa
atcacgaattaa

DBGET integrated database retrieval system