KEGG   Bacillus subtilis subsp. subtilis 168: BSU02630
Entry
BSU02630          CDS       T00010                                 

Symbol
tatAD
Name
(RefSeq) Sec-independent protein translocase protein TatAd
  KO
K03116  sec-independent protein translocase protein TatA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU02630 (tatAD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU02630 (tatAD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU02630 (tatAD)
Secretion system [BR:bsu02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   BSU02630 (tatAD)
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-GeneID: 938398
NCBI-ProteinID: NP_388145
Pasteur: BG12777
BSORF: BG12777
UniProt: O31467 A0A6M3Z7N0
Structure
Position
285775..285987
AA seq 70 aa
MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATKSLVSGDEKEEKSAEL
TAVKQDKNAG
NT seq 213 nt   +upstreamnt  +downstreamnt
atgttttcaaacattggaataccgggcttgattctcatcttcgtcatcgccctcattatt
tttggcccttccaagctgccggaaatcgggcgtgccgccggacggacactgctggaattt
aaaagcgccacaaaatcacttgtgtctggtgatgaaaaagaagagaaatcagctgagctg
acagcggtaaagcaggacaaaaacgcgggctga

DBGET integrated database retrieval system