KEGG   Bacillus subtilis subsp. subtilis 168: BSU02650
Entry
BSU02650          CDS       T00010                                 

Symbol
pcp
Name
(RefSeq) pyrrolidone-carboxylate peptidase
  KO
K01304  pyroglutamyl-peptidase [EC:3.4.19.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU02650 (pcp)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.3  pyroglutamyl-peptidase I
     BSU02650 (pcp)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C15: pyroglutamyl peptidase I family
   BSU02650 (pcp)
SSDB
Motif
Pfam: Peptidase_C15 MGDG_synth
Other DBs
NCBI-GeneID: 938396
NCBI-ProteinID: NP_388147
Pasteur: BG10873
BSORF: BG10873
UniProt: P28618 A0A6M4JI67
Position
complement(286773..287420)
AA seq 215 aa
MRKKVLITGFDPFDKETVNPSWEAAKRLNGFETEEAIITAEQIPTVFRSALDTLRQAIQK
HQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEEISPDGPAAYWTRLPVK
RMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIRGGFIHIPYIPQQTIDKT
APSLSLDTIVRALRIAAVTAAQYDEDVKSPGGTLH
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagaaaaaaagtgctgatcacaggctttgacccttttgacaaagaaaccgtcaatcca
tcatgggaagcggcgaaacggcttaatggcttcgagacagaagaagccattattacagcg
gaacaaattccaaccgtctttagatccgctctggacactctgcgccaagccattcaaaaa
catcagccagatatcgtaatttgtgtcggccaagcaggaggacggatgcagattacaccg
gaacgagtggcaatcaaccttgcagatgcgcgaatccccgataacgaaggacatcagccg
attgatgaagagatttctccagatgggcccgccgcttactggacaaggcttcccgtgaaa
cgaatgactgctaagatgaaggaacacggcattccagctgcggtttcctacacagcgggg
acctttgtatgcaactatttgttctacgggttaatggatcacattagccggacatcccca
cacattcgcggcggttttattcatattccttacattccgcagcaaacaatcgacaaaaca
gcgccgagcctcagcctggacacgattgtccgggcattgagaatcgccgctgttacggcc
gcacaatatgatgaggatgtgaagtcaccgggtggtacgctgcactaa

DBGET integrated database retrieval system