KEGG   Bacillus subtilis subsp. subtilis 168: BSU02660
Entry
BSU02660          CDS       T00010                                 

Gene name
ycbU
Definition
(RefSeq) aminotransferase YcbU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 938393
NCBI-ProteinID: NP_388148
Pasteur: BG11176
BSORF: BG11176
UniProt: P42253 A0A6M3Z723
Position
287499..288611
AA seq 370 aa
MEHLPEQYRQLFPTLQTHTMLASCSQSALAEPVSRAIQDYYDSLLYKGTNWKEAIEKTEF
ARNEFAKLIGAEPDEVAIVPSVSDALVSVASSLTAFGKKHVVYTDMDFPAVPHVWQAHSD
YTVSVIPSIDGVLPLEQYETHISDETVLTCVPHVHYRDGYVQDIKAIAEISQRKGSLLFV
DAYQSAGHIPIDVKEWGVDMLAAGTRKYLLGIPGVAFLYVRKELADALKPKASAWFGRES
GFDGAYAKVARRFQTGTPAFISVYAAAAALSLLNHIGVSHIRDHVKTICADAVQYAAEKG
LQLAAAQGGIQPGMVAIRDERASETAGLLKKKKVICAPRENVIRLAPHFYNTKEEMRHAI
DEIAAKTIHK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggagcatttgccggagcagtatcgccagttattcccaaccttgcagacgcatacgatg
cttgccagctgttctcagagcgcattggcagagcctgtatcaagggcgatccaggattat
tatgatagcctgctgtataaagggacgaactggaaagaagcgattgaaaaaacagagttt
gcgagaaacgagtttgcaaagctgatcggggctgaaccggatgaagtggcgattgtgccg
tcagtttctgatgcactggtttctgtagcatcgtccttaactgcatttggaaagaagcac
gttgtatatacagatatggattttccggcggtgcctcatgtttggcaggcacactccgat
tataccgtatccgtcattccatcaatagacggcgtgctgccgcttgaacaatatgaaacg
catatttcggatgaaacagtactgacgtgtgttcctcacgttcattatcgtgacggctat
gttcaggatataaaagcgattgccgagatttctcagagaaagggctctttattgtttgta
gatgcttatcaatcagccgggcatattcccattgatgtgaaggaatggggcgtagatatg
ctggcagcaggcacccggaagtatttgctcggcataccgggtgtggcgtttctttatgtg
agaaaggagctggctgacgcactgaagccgaaagcatcagcttggttcggaagagagagc
ggatttgatggggcttatgcaaaagtcgcgcgccgttttcaaacgggcaccccagctttt
atcagcgtatacgcagctgcagcggctttatcgctgctgaatcatattggggtttctcat
atcagggatcatgtgaaaacgatctgtgccgatgcagttcaatatgccgctgaaaaaggc
ctgcagctggcggcggcacaaggtgggattcagccgggcatggttgcgatccgggatgag
cgggcatcggaaacggcggggttgctgaagaagaaaaaagtgatttgcgcgccgcgggaa
aatgttatccgtctcgctccccatttttataatacgaaggaggaaatgcggcacgcgatt
gatgaaatcgcggcgaaaacgatccacaagtaa

DBGET integrated database retrieval system