KEGG   Bacillus subtilis subsp. subtilis 168: BSU02670Help
Entry
BSU02670          CDS       T00010                                 

Gene name
lmrB
Definition
(RefSeq) lincomycin resistance protein LmrB
  KO
K18926  MFS transporter, DHA2 family, lincomycin resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00715  Lincosamide resistance, efflux pump LmrB
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02670 (lmrB)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    BSU02670 (lmrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 938388
NCBI-ProteinID: NP_388149
Pasteur: BG12613
BSORF: BG12613
UniProt: O35018
Position
complement(288653..290092)
Genome map
AA seq 479 aa AA seqDB search
MILETTAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMKELNITAATVQWLTTG
YLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIAALAPSFSFLLAARIVQALGTG
LLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGLVLEHLNWHWIFWISLPF
LVLALVFGIAYMQNVSETTKPKIDVLSIILSTIGFGGIVFGFSNAGEGSGGWSSPTVIVS
LIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVFICMMVILSSMLLLPMYLQG
GLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYGPKWLVIPGFVIVTVVLWFFSNVTTT
STAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPDGTAIMNTLQQMAGAIGTAVAV
SIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFAMIVAIIGLIGAFFMKRVKVDH
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgattttggaaacaacagctaaagcatctcagcaatacaaagtgatgccgattatgatt
tccttgctgttggccggttttatcggcatgttcagtgaaacagcgctgaatattgcgtta
accgaccttatgaaggaattgaacattacagcggcaaccgtccaatggttaacgacgggc
tacctgcttgtactcggtatccttgttcctgtttcaggactgctgttgcagtggttcaca
acaagacagctttttaccgtgtcacttatcttttcaattttaggtacattcattgcggcg
cttgcgccgagcttctcgtttttattagcggcaaggatcgttcaggcacttggaaccggt
cttttactgccgctgatgtttaacacaatcttggtgattttcccgcctcataaacggggt
gccgcaatgggaacgatcgggcttgtcattatgttcgcgcccgccatcggcccaactttc
tcaggattggttctggagcatctcaactggcactggattttctggatctctcttccattc
cttgtgctggcgcttgttttcggtatcgcatatatgcaaaatgtatctgaaacgacaaag
ccgaaaatcgatgtattgtctatcatcctgtcgacgattggcttcggcggcattgtattc
ggattcagcaacgcgggtgaaggctccgggggatggtccagcccgactgttatcgtgtcg
ctgattgtcggcgttgtcggccttatcttattttcaatccgccagctgacaatgaagcag
cctatgatgaacctccgtgcgttcaaatacccgatgtttattttgggtgtgatcatggtg
ttcatttgtatgatggtcattctgtcatctatgctgcttctgccgatgtatctgcaaggc
ggcttagtcctcactgcatttgcatctggtcttgttctcttgccgggcggtattttaaat
ggatttatgtcccctgttacaggccgcttgttcgataaatacgggccgaaatggcttgtc
attccgggatttgtgattgtcaccgttgtactatggttcttctcaaatgtcacgaccact
tcaacagctgtgctgattatcatcctgcacacctgcttgatgatcgggatttctatgatc
atgatgcctgcacagacaaacggtttaaaccaactgccgcgtgaattttatccagacggc
accgccattatgaacacgctgcagcaaatggccggcgctatcggaacagcggttgcggtc
agcattatggctgcaggccagcatgattatatgagtacagttaaaaaccctgccgatccg
gcagtcatcccgcaagctttgacagcaggcgtacagcacgcatttgtgtttgcaatgatt
gttgccattatcggtttaattggcgctttctttatgaaacgcgttaaagtagatcattaa

DBGET integrated database retrieval system