KEGG   Bacillus subtilis subsp. subtilis 168: BSU02680
Entry
BSU02680          CDS       T00010                                 

Symbol
lmrA
Name
(RefSeq) TetR family transcriptional regulator
  KO
K18939  TetR/AcrR family transcriptional regulator, lmrAB and yxaGH operons repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU02680 (lmrA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    BSU02680 (lmrA)
SSDB
Motif
Pfam: TetR_N TetR_C_13 TetR_C_6 RNA_pol
Other DBs
NCBI-GeneID: 938385
NCBI-ProteinID: NP_388150
Pasteur: BG12612
BSORF: BG12612
UniProt: O34619 A0A6M4JEL2
Position
complement(290132..290698)
AA seq 188 aa
MSYGDSREKILSAATRLFQLQGYYGTGLNQIIKESGAPKGSLYYHFPGGKEQLAIEAVNE
MKEYIRQKIADCMEACTDPAEGIQAFLKELSCQFSCTEDIEGLPVGLLAAETSLKSEPLR
EACHEAYKEWASVYEEKLRQTGCSESRAKEASTVVNAMIEGGILLSLTAKNSTPLLHISS
CIPDLLKR
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagttatggagattcccgtgagaaaatcctttcggcagctacccggctttttcagctg
caagggtattacggcacggggctgaaccagattataaaggaaagcggcgcgcctaaaggc
tctctttactaccactttcccgggggtaaagaacagcttgcgatcgaagccgtgaatgag
atgaaggagtatatccgtcagaaaatcgcggactgcatggaagcctgcaccgatccagcg
gaaggcattcaagcctttttgaaggagctctcctgccagttttcatgtacggaagacatt
gaaggcttgcctgtgggcttgctagcggctgagacgtcattgaaaagcgaaccgttgcgc
gaagcctgtcatgaagcctacaaagaatgggcctctgtgtatgaggaaaaactgcggcag
actggctgcagcgagagccgtgcaaaagaagccagcactgtggttaacgcgatgattgaa
ggcggcatccttttatctttgacggcaaaaaacagtacgccgctccttcatatctccagc
tgcattcctgacctgctgaagagataa

DBGET integrated database retrieval system