KEGG   Bacillus subtilis subsp. subtilis 168: BSU02690
Entry
BSU02690          CDS       T00010                                 

Symbol
ansZ
Name
(RefSeq) asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00460  Cyanoamino acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU02690 (ansZ)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BSU02690 (ansZ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     BSU02690 (ansZ)
SSDB
Motif
Pfam: Asparaginase Asparaginase_C
Other DBs
NCBI-GeneID: 938392
NCBI-ProteinID: NP_388151
Pasteur: BG12755
BSORF: BG12755
UniProt: O34482 A0A6M3Z701
Position
290915..292042
AA seq 375 aa
MKKQRMLVLFTALLFVFTGCSHSPETKESPKEKAQTQKVSSASASEKKDLPNIRILATGG
TIAGADQSKTSTTEYKAGVVGVESLIEAVPEMKDIANVSGEQIVNVGSTNIDNKILLKLA
KRINHLLASDDVDGIVVTHGTDTLEETAYFLNLTVKSDKPVVIVGSMRPSTAISADGPSN
LYNAVKVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDTFKSEEMGFVGTIADDIYF
NNEITRKHTKDTDFSVSNLDELPQVDIIYGYQNDGSYLFDAAVKAGAKGIVFAGSGNGSL
SDAAEKGADSAVKKGVTVVRSTRTGNGVVTPNQDYAEKDLLASNSLNPQKARMLLMLALT
KTNDPQKIQAYFNEY
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaaaaaacaacgaatgctcgtactttttaccgcactattgtttgtttttaccggatgt
tcacattctcctgaaacaaaagaatccccgaaagaaaaagctcagacacaaaaagtctct
tcggcttctgcctctgaaaaaaaggatctgccaaacattagaattttagcgacaggaggc
acgatagctggtgccgatcaatcgaaaacctcaacaactgaatataaagcaggtgttgtc
ggcgttgaatcactgatcgaggcagttccagaaatgaaggacattgcaaacgtcagcggc
gagcagattgttaacgtcggcagcacaaatattgataataaaatattgctgaagctggcg
aaacgcatcaaccacttgctcgcttcagatgatgtagacggaatcgtcgtgactcatgga
acagatacattggaggaaaccgcttattttttgaatcttaccgtgaaaagtgataaaccg
gttgttattgtcggttcgatgagaccttccacagccatcagcgctgatgggccttctaac
ctgtacaatgcagtgaaagtggcaggtgcccctgaggcaaaagggaaagggacgcttgtt
gttcttaacgaccggattgcctcagcccgatatgtcaccaaaacaaacacaactacaaca
gatacatttaaatcagaagaaatgggcttcgtcggaacaattgcagatgatatctatttt
aataatgagattacccgtaagcatacgaaggacacggatttctcggtttctaatcttgat
gagctgccgcaggttgacattatctatggataccaaaatgacggaagctacctgtttgac
gctgctgtaaaagccggagcaaaggggattgtatttgccggttctgggaacgggtcttta
tctgatgcagccgaaaaaggggcggacagcgcagtcaaaaaaggcgttacagtggtgcgc
tctacccgcacgggaaatggtgtcgtcacaccaaaccaagactatgcggaaaaggacttg
ctggcatcgaactctttaaacccccaaaaagcacggatgttgctgatgcttgcgcttacc
aaaacaaatgatcctcaaaaaatccaagcttatttcaatgagtattga

DBGET integrated database retrieval system