KEGG   Bacillus subtilis subsp. subtilis 168: BSU02710
Entry
BSU02710          CDS       T00010                                 

Symbol
yczC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RDD AsmA
Other DBs
NCBI-GeneID: 938390
NCBI-ProteinID: NP_388153
Pasteur: BG12778
BSORF: BG12778
UniProt: O31469 A0A6M4JEW1
Position
complement(292881..293264)
AA seq 127 aa
MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILMLIVYPLLMPLTNWKG
TLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLTAAFTKKKQTVHDMAAK
TIVLKAE
NT seq 384 nt   +upstreamnt  +downstreamnt
ttggaactagctggtttcatgctgcgcgcctgcgctcttttacttgatgtaatcattgcc
gcagcagtgattttggcagccggatttacgtttggcgatgggtccgccggtgtcattatt
gtcgccatattgatgctgattgtgtaccctttgctgatgccgctgacaaattggaagggc
acactgggcaaaaaaatcatcgggctgcaaatcgtgagggacgaaacatataaaaaaata
tccttcccgcaagccattgtccgttacctgatagcgtgggtgcatgtgttctcccgcctg
atctatttgactgccgcatttacgaagaaaaaacaaaccgttcatgatatggctgcgaaa
accattgtgctgaaagcagaataa

DBGET integrated database retrieval system