KEGG   Bacillus subtilis subsp. subtilis 168: BSU02740
Entry
BSU02740          CDS       T00010                                 

Symbol
natR
Name
(RefSeq) transcriptional regulator
  KO
K11641  two-component system, LytTR family, response regulator NatR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU02740 (natR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU02740 (natR)
Two-component system [BR:bsu02022]
 LytTR family
  NatK-NatR (sodium extrusion)
   BSU02740 (natR)
SSDB
Motif
Pfam: Response_reg LytTR
Other DBs
NCBI-GeneID: 938379
NCBI-ProteinID: NP_388156
Pasteur: BG11998
BSORF: BG11998
UniProt: P70955 A0A6M4JJR5
Position
complement(295584..296285)
AA seq 233 aa
MVKVGLVDDYRVDLEKLEAIVSRMQDVEIVFSTDSAKEAYRRVKNGDIDLLLADIEMPHM
SGYELADLIKSHSLDVDVIFVTGHGGYAVHAFDLNVHDYIMKPYYADRLAASFDRYLKKK
TETSLNGRILIKQKSEMHVLQKKDIIFAERTGRSTTIVTTAEEVQTYQTLNDIKGDLPEK
DFLRSHRSFIINIHYIKHFSAYTKHSFTVSFEGTSKKAMITKQQLDYFQNYYF
NT seq 702 nt   +upstreamnt  +downstreamnt
atggtaaaagtcggacttgtagatgattatcgagtagatttagagaagttagaagcgatc
gtgtccagaatgcaggacgtcgaaattgtcttttccaccgattcagcgaaggaagcctac
aggcgggtaaagaacggagacattgatctgctgcttgccgatatcgagatgccccatatg
tctggctacgagcttgctgatttgatcaaatcccattcacttgatgtggatgtgattttt
gttaccggccacggcggttatgcggttcacgcctttgacctgaacgtccatgattatatt
atgaagccgtactatgccgaccgtctggccgcttccttcgaccggtacttgaaaaagaaa
acggaaacgagtttgaatgggcgtatattgataaagcaaaagtctgaaatgcacgtcctg
caaaagaaggatattattttcgcagaacggacgggacgttcgacgacgattgtgacaacc
gccgaagaggtgcaaacgtatcaaacattaaatgatattaaaggcgacctgcccgaaaaa
gattttcttcgttcgcatcgttcctttattatcaacattcattacataaagcatttttcc
gcttataccaagcattcattcacagtttcctttgagggaacgtctaaaaaagcgatgatc
actaagcagcagcttgattattttcaaaactactatttttga

DBGET integrated database retrieval system