KEGG   Bacillus subtilis subsp. subtilis 168: BSU02760
Entry
BSU02760          CDS       T00010                                 

Symbol
natB
Name
(RefSeq) sodium efflux ABC transporter permease NatB
  KO
K09696  sodium transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02760 (natB)
  09132 Signal transduction
   02020 Two-component system
    BSU02760 (natB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02760 (natB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Sodium transporter
    BSU02760 (natB)
SSDB
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_3 ABC2_membrane_4 ABC2_membrane_5 LsmAD
Other DBs
NCBI-GeneID: 938383
NCBI-ProteinID: NP_388158
Pasteur: BG11339
BSORF: BG11339
UniProt: P46904 A0A6M4JCI0
Position
297170..298330
AA seq 386 aa
MLSHIYKKEMIDALRDRKTILLTILVPMIMMLGLVFFYESMLSDKGEQYTLAVGHSLPPA
LESKLNEIDEISVKTFAKPEEAVDEGKADAYLNVPKEFDSYVNSMTPFKVDVYGNSIDQG
SSNAMQLVQSALDQYKNEIVQQRLTNKHIDQSVIQPFTIQQKEADEEKGTSAIMLSAILP
MLILTSIVSGAMPIALDIMAGEKDRKSIEALLLTPVSRNKVLVGKWLAVSTFGVASGVFA
LVFLILSTVLFTENLKTAFQLGDHMWSVIGASALIIVLSALLISAMELFISIMSSSVKEA
QSYMSLVVFLPVFPMFFIFSKAPNQFDLSYFLIPFLNLHALFKQLLFGMVDPATILSTSG
TIAVLIAIFFLLARACFLKDKWVLPK
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctgagccatatttataaaaaagaaatgatcgacgctttacgcgacagaaaaacgata
ttactcacaatcttagtgccgatgattatgatgcttggacttgtctttttttatgaaagc
atgctgtccgacaaaggggagcagtacacgctggctgtcggccattcgcttccgcccgca
ctggaaagcaagcttaatgagattgacgaaatcagcgtaaaaacatttgcaaagcctgaa
gaggcagttgatgaaggaaaagcagatgcctatctgaacgtcccgaaagagttcgactca
tatgtcaacagcatgacaccttttaaggttgatgtttacggcaattcaatcgatcaaggg
tcgtcaaatgccatgcagcttgtgcagtctgccttagatcagtacaaaaatgaaattgtg
cagcaacgtttaacaaataagcatattgatcaatcggtgatccagccgtttacaattcag
caaaaggaagcggatgaggagaaagggacttccgctattatgctttccgccattctgccc
atgctgattctgacttccattgtttccggcgcaatgccgatcgctcttgatatcatggcc
ggtgaaaaggaccgaaagtcaatcgaggcgctgctattaacgccagtcagcagaaacaaa
gtgctggtcggcaagtggcttgcggtttccacttttggcgtggcttcaggtgtatttgct
ttggtgtttttgattttgtccaccgtgttatttaccgaaaatttaaaaacggccttccag
ctgggagatcatatgtggagtgtaatcggcgcttcagccttaatcattgtgctctctgca
ttgctgatatctgcgatggagcttttcatcagcatcatgtccagctcggtaaaagaagcg
caaagttatatgtctctcgtcgtctttctgcctgtgttcccgatgtttttcatcttcagc
aaggcaccgaaccaatttgacttatcatactttctcatcccgtttctgaacctgcatgcg
ttatttaaacagcttttattcgggatggttgacccggctaccattttgtctacgtcagga
accatcgccgtgctcatcgccatcttctttttactagccagagcctgcttcctgaaagac
aaatgggttcttccaaaataa

DBGET integrated database retrieval system