KEGG   Bacillus subtilis subsp. subtilis 168: BSU02770
Entry
BSU02770          CDS       T00010                                 

Symbol
yccK
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 938384
NCBI-ProteinID: NP_388159
Pasteur: BG11340
BSORF: BG11340
UniProt: P46905 A0A6M3Z796
Position
298466..299398
AA seq 310 aa
MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYG
LGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREFLRSEVEKSLKRLKTDY
IDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQLQDFNADGYLEVFQAEY
SLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTVFDDFRKDKPQFQGETFIH
NLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAKRPEQLQDNLKTLNIELTED
EVNFISDIFK
NT seq 933 nt   +upstreamnt  +downstreamnt
atggatcaaacacgtacactcggcaaaacgaagctgaaggtgaagcggatcggattcggc
gcgaatgcggtcggcgggcataatctatttccaaatctaaatgatgaaacagggaaggat
ttagtgcgcacggcattggatggcggcgtcaattttatcgataccgcctttatatatgga
ttggggcgatctgaagaattaatcggcgaagtcgtacaggaacgcggcgtgcggaatgag
ctcatcatcgccaccaaaggagctcataaagaagtggacggcagcattgaattagacaat
agccgggagtttcttcgcagcgaggtggagaagagcctgaagcggctgaaaacagattac
attgatttgtattatgttcactttccggatggaaaaacacctctcgctgaagtggcgggc
actttgaaagagctgaaggatgaggggaaaatcaaagcgatcggcgcttcgaacctcgat
tatcagcaattgcaggattttaatgctgacggctatttggaggtcttccaggccgaatat
tctctcatacagcgtgatgccgagaaagagcttcttccatactgtgaaaaacaaggcatc
tcctttattccttactttccgcttgcgtccggactgctgacaggaaaattcacgcaagac
acagtctttgatgatttcagaaaggataaacctcaatttcagggtgaaacgtttatccac
aatctcaaaaaagtagataagctgaaagcagtagcggaggaaaaacaagcggatacggca
catgtcgccttggcgtggctgttaacgagaccggcgattgatgccattattccaggagct
aaacgaccggagcaattacaggataacctgaaaaccttgaacattgaactgaccgaagat
gaagtgaatttcatcagcgacattttcaaataa

DBGET integrated database retrieval system