KEGG   Bacillus subtilis subsp. subtilis 168: BSU02780Help
Entry
BSU02780          CDS       T00010                                 

Gene name
ycdA
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5105 DUF4352 DUF3888
Motif
Other DBs
NCBI-GeneID: 938380
NCBI-ProteinID: NP_388160
Pasteur: BG12757
BSORF: BG12757
UniProt: O34538
Structure
PDB: 

Position
complement(299438..300502)
Genome map
AA seq 354 aa AA seqDB search
MFQKKTYAVFLILLLMMFTAACSGSKTSAEKKESETEKSSDIAQVKIKDVSYTLPSKYDK
STSDDQLVLKVNVAVKNTGKDPLNVDSMDFTLYQGDTKMSDTDPEDYSEKLQGSTINADK
SVEGNLFFVVDKGKQYELNYTPESYGDKKPKSVTFKIDGKDKKILATADKLQDSAKALSA
YVDVLLFGKDNADFEKITGANKNEIVNDFNESAKDGYLSASGLSSTYADSKALDNIVNGI
KEGLSKNSSIQAKTTSISKDEAIVEATVKPVDASSLSDRIEDKVKDYYSKNSSASYEEAV
KYALQVYPEEFKKLGPASSEKTVEVKMKKNDIDQWQLDMDDYRAAELVEAFIKE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagaaaaaaacgtacgctgttttcctaattcttctgctgatgatgtttacagct
gcttgttccggcagcaaaacaagcgcggagaagaaagaatcagaaacagaaaaaagctca
gatatagctcaagtcaaaatcaaggatgtctcttacacacttccgtctaaatatgataag
tccacttcagatgaccagcttgtgttaaaagtcaatgtcgcggtgaaaaacacaggaaaa
gacccgctgaatgtagacagtatggatttcacattgtatcaaggtgataccaaaatgtct
gacacagaccctgaagactatagcgaaaagcttcagggcagcacgattaacgctgacaaa
tccgttgaaggaaatcttttcttcgttgtagataaaggcaagcaatacgagcttaactat
acgccggaatcttacggtgataaaaagccaaaatcagttacttttaaaattgacggaaaa
gacaaaaaaatcctggcgacggcagataagctccaagattctgcaaaagcgttatcagct
tatgttgatgtccttcttttcggcaaagataacgccgatttcgaaaaaatcaccggcgct
aacaaaaatgaaattgtaaatgattttaatgaatcagccaaagacggttatctctcagct
tccggcctttccagcacatatgcggacagcaaagcgcttgataatatcgtgaacggcatt
aaagagggattaagcaaaaactcttccattcaagcaaaaacgacttcaatctctaaagac
gaagcaattgttgaagccacagttaaacctgtagatgcatcttctctttcagaccgcatc
gaagacaaagtgaaagactactacagtaaaaactctagtgccagctatgaagaggcagtg
aaatacgcgcttcaagtctatcctgaggaattcaaaaagcttggacctgcttcatctgaa
aaaacagttgaagtgaaaatgaagaaaaatgacatcgaccaatggcagcttgatatggat
gattacagagcagcagaattagtcgaagcattcatcaaagaataa

DBGET integrated database retrieval system