KEGG   Bacillus subtilis subsp. subtilis 168: BSU02790Help
Entry
BSU02790          CDS       T00010                                 

Gene name
ycdB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4901 PepSY Clr5
Motif
Other DBs
NCBI-GeneID: 938381
NCBI-ProteinID: NP_388161
Pasteur: BG12758
BSORF: BG12758
UniProt: O34621
Position
300830..302248
Genome map
AA seq 472 aa AA seqDB search
MKGAAFVKKEGLKQKALEIGRVPTHLKLEIEDYGGDDKRAHFCWADPQDENTGIIVELGP
DGELESLSRDIEPESGERLSEEKLEDIMRQFVETHHPGALSAFVREENDRAYGDKVRFSY
VQMEAGLPLPMSGFMADVSLSGEIVYFRYYGEAGSIIKPKRVADVEEALAFIKKDVEFDL
LFEVLHRSVYKNGDDQPHLVYEPEGRAITVPADLVQEEQAVDDDDDYREPESFPLPLFEG
IREKADPDSMIGIENGFVKEREADLGDGRIGIVWRNPDDPVYQPADKSMDSWFKGRTHQV
LKTIYNKETGKLEGVMSFMEKKGPLTVTLAECEKIALRFLFALFPNADQYFRIRYDEKDE
EENAVAGFTFEAHCHGVPLRFGQIRICVSRQTGYITVYMGPDIDPNKLATIDPVPAISVE
QAKSIFWQHFKVELGWEREYGDDEEHSYRLVYKPVYPHFIDAHTGEPVFSIW
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggggccgcctttgtgaagaaagagggactgaaacaaaaagcactggaaatcggc
cgggtgccgacacacttaaaactggaaattgaagattatggcggtgatgataaaagagct
catttttgttgggcagatcctcaggatgagaataccggcattatcgtggagcttggaccg
gacggagagctggaatccctttcccgtgatattgagcctgaaagcggagaaaggctgtct
gaggagaaactagaggatatcatgcgccaatttgtcgagactcatcatccgggggcactc
tctgcctttgttcgtgaagaaaatgaccgtgcatacggcgataaagtgagattttcatat
gttcaaatggaggctgggcttcctctccccatgagcggatttatggctgatgtttcctta
tcaggtgagattgtttacttccgttattacggcgaagcgggcagcatcatcaagccaaag
cgggtcgcggatgttgaagaggcacttgcctttatcaagaaggacgtggagttcgacctt
ttgtttgaggttctccatcgttctgtttacaaaaacggagatgatcagccgcatttggtg
tacgagcctgaaggtagggcgattaccgtacctgcggatttggttcaagaagaacaagca
gttgatgatgacgatgattacagggagccggagagctttcctctccctttattcgagggc
atccgcgaaaaggccgatcctgacagcatgattggtattgaaaatgggtttgtcaaagag
cgggaagcggatttgggagatgggagaattggaatcgtttggcggaatccggatgaccct
gtgtatcagccggcggataaaagcatggacagctggtttaagggacggactcatcaagtg
ctgaaaaccatctataacaaagaaaccggaaaactcgaaggcgtcatgtcatttatggag
aaaaaagggccgctgacagtaaccttggcagagtgtgaaaaaatcgcgcttcgctttcta
tttgctttatttccgaatgccgatcaatattttaggatcagatacgacgaaaaagatgaa
gaagaaaacgcagtcgctggttttacgtttgaagcgcattgtcacggagttccgctccga
tttgggcagatcagaatttgtgtcagccgccagacagggtatatcaccgtttatatggga
ccggatattgacccaaataagctggcaaccattgatcctgtgccggctatttcagttgaa
caagccaagtctatcttttggcagcattttaaagttgagcttggctgggaaagagagtac
ggggatgatgaagaacacagctaccggctcgtctataagccggtgtatccgcattttatc
gatgcacatacaggggagcctgtcttcagcatatggtga

DBGET integrated database retrieval system