KEGG   Bacillus subtilis subsp. subtilis 168: BSU02800
Entry
BSU02800          CDS       T00010                                 
Symbol
ycdC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4901
Other DBs
NCBI-GeneID: 938376
NCBI-ProteinID: NP_388162
Pasteur: BG12759
BSORF: BG12759
UniProt: O34772 A0A6M3Z7C8
Position
302435..303796
AA seq 453 aa
MVNKQLKKKAQEIGNVPTHYELEIEDYDQKQKKYGQAYFIWKDPKDPEKHITVELRNDGA
LLTFSTTVHSETDKKLPDAELKLTALQFAAANHPGTFMNFHFQGKEERGQHIRFVYTKME
LGLPIPNSGFLIDMTRSGQIVHFLYYGEGHKAEVPTEFVAKEKVVSHYLNTMSFELMYDV
IDGEQEPRLVYEPILPGYSYPADVDEIVPDQHIADERIENTAPLPPLQNKEEVDIFALLG
FTSDMQKVSERDFGEQIGSTWRRGAAPERKDLSIGSYFETRNKNTIKMKTDKRTGKLKAA
LSFMDWRNNLQCSTEECQEIALQFLYALYPRAAEFFRVNPVRIDERGRVRNHFSVWYKGV
PLRFGAARIIVNPETGLIDAFMAPDIEPEQLEAINHRPDVSAEEAKEAFLAAFDVKLEWQ
PDFTAGSDQHCKLVYKPVYPSYIDAHIRKKKRL
NT seq 1362 nt   +upstreamnt  +downstreamnt
ttggttaataaacagctgaaaaagaaggcgcaggagatcggaaatgtaccgacgcattat
gagcttgagatagaagattacgaccaaaagcaaaagaagtacgggcaggcatattttatc
tggaaggaccctaaagatccggaaaagcacattacagttgaacttagaaatgacggcgcc
ttgctcaccttttcaacaactgtccactccgagacagacaaaaaacttccagatgccgag
ctgaagctgacggctcttcagtttgccgctgccaatcatcccggcacatttatgaatttt
cattttcaaggcaaggaagaaagggggcagcacatccggtttgtctataccaaaatggag
ctggggcttccgattcccaattcaggctttttaattgatatgacacgaagcggtcagatt
gtccactttctatattacggggaagggcataaagccgaagttccgacggaatttgtagca
aaagagaaggttgtatcccattacttaaacacaatgtcttttgagctgatgtacgatgtc
attgatggcgaacaggaaccaaggcttgtatatgaaccgattctaccgggatacagctat
cccgcagatgtagacgaaattgtgcccgaccagcatatcgcagatgaaagaatagaaaac
acggcgccactgccgccgcttcagaacaaggaagaagttgatatatttgccttgctgggt
tttacctctgatatgcagaaagtcagtgaaagagactttggagaacaaattggaagcacg
tggcgcaggggcgctgcgccggagcgtaaggatttaagcataggaagctattttgaaacg
agaaataaaaatacaatcaaaatgaagacggataaaagaaccggaaaattaaaagcagcg
ctttcttttatggactggcggaacaacctccaatgctccacggaagaatgccaagagata
gcgcttcaatttttgtatgccctctatccgagagcggctgagtttttcagggtgaatccc
gtccgaattgatgaaagagggagagtccgcaaccatttttctgtctggtataaaggagtg
ccgctgcggttcggcgctgcccgcatcattgtcaatccggaaactgggttgattgacgct
tttatggcgcctgatattgaacctgaacaattggaagcgataaatcacaggccggatgtt
tccgctgaagaagcgaaagaagcatttttagccgcttttgatgtgaaactggaatggcag
cctgattttacagcaggcagtgaccagcactgcaaacttgtctataagccggtttaccct
tcctatattgatgcgcacataaggaaaaagaaaaggctgtga

DBGET integrated database retrieval system