KEGG   Bacillus subtilis subsp. subtilis 168: BSU02810Help
Entry
BSU02810          CDS       T00010                                 

Gene name
cwlK
Definition
(RefSeq) peptidoglycan L-alanyl-D-glutamate endopeptidase CwlK
  KO
K17733  peptidoglycan LD-endopeptidase CwlK [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU02810 (cwlK)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU02810 (cwlK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU02810 (cwlK)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   BSU02810 (cwlK)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   BSU02810 (cwlK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M15_4 VanY
Motif
Other DBs
NCBI-GeneID: 938378
NCBI-ProteinID: NP_388163
Pasteur: BG12760
BSORF: BG12760
UniProt: O34360
Position
complement(303804..304307)
Genome map
AA seq 167 aa AA seqDB search
MNLPAKTFVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHPIVKQNADALKAAAAN
KGIDVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNYGLAIDFALQKKDGSII
WDMEYDGNQNGKSDWLEVVEIAKTLGFEWGGDWKRFKDYPHLEMIPN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacccgcaaaaacatttgttatcttatgtattctatttcttctagatctttgt
tttagttatattcggcatgaatggcattctcaaaacgccttgcaggacatgcctgtcccc
tcggatcttcatccgattgtgaagcagaatgccgatgcactcaaagccgctgcagcgaat
aaaggcattgacgtcgtcattactgaaggattcaggtcctttaaggaacaagatgaatta
tataaacagggacgtacaaaaaaagggaatattgtcacctatgcaagaggaggggaatcg
tatcataactatggtttagcgattgatttcgcccttcaaaaaaaggatggcagcatcata
tgggatatggaatatgacggcaatcaaaacggaaaatcagattggctggaggttgtcgag
atcgctaagacactcggtttcgaatggggcggggattggaaacgattcaaggactacccc
cacttggagatgattcctaactag

DBGET integrated database retrieval system