KEGG   Bacillus subtilis subsp. subtilis 168: BSU02820Help
Entry
BSU02820          CDS       T00010                                 

Gene name
rapJ
Definition
(RefSeq) response regulator aspartate phosphatase J
  KO
K06368  response regulator aspartate phosphatase J [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU02820 (rapJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU02820 (rapJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RapH_N TPR_12 TPR_1 TPR_2 TPR_MalT TPR_7 TPR_8 SNAP TPR_10 TPR_16 TPR_11 PPR nos_propeller TPR_19 PPR_1
Motif
Other DBs
NCBI-GeneID: 938373
NCBI-ProteinID: NP_388164
Pasteur: BG12663
BSORF: BG12663
UniProt: O34327
Structure
PDB: 

Position
304430..305551
Genome map
AA seq 373 aa AA seqDB search
MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRH
RIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYFRGMYEFKQKNFILAID
HYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRV
QCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAE
GYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTK
FRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRL
MNIKKKLAEQRFQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaaagattccatcagaagaagtagcagtaaagctgaatgaatggtacaagctc
attcgcgcatttgaagcagatcaagcagaagcgttaaagcaggagattgaatatgattta
gaagatatggaagagaatcaggacttgcttttatatttttctttgatggaattccggcat
cgaatcatgcttgataagctgatgccggtgaaagacagcgataccaagcctccgttctct
gatatgctgaacgaaattgaaagcaatcagcaaaaactcacgggcttactggaatactac
ttttattatttcagaggaatgtacgaattcaagcagaaaaatttcatattagcgattgac
cattataaacatgccgaggaaaagctcgagtatgtcgaggatgagatcgaaaaagctgag
tttctttttaaagtcgcagaagtgtattatcacatcaaacaaacgtatttttccatgaat
tatgcgagccaggcgcttgatatctatacgaaatatgaactgtacggtcgccgccgggtt
cagtgtgaatttatcatcgccggaaatttgaccgatgtgtatcatcatgaaaaagcactg
acccacttgtgcagcgctttagaacatgccaggcagcttgaagaagcgtacatgatcgct
gctgcctattataatgtcggacactgtaagtacagtctgggtgattacaaagaagcggag
ggctatttcaaaacagccgccgccatttttgaggagcacaactttcagcaagctgttcaa
gctgtattttcactgacccatatctactgtaaagagggaaaatacgacaaggcagtagag
gcttatgaccgcgggataaagagcgcggctgaatgggaggatgacatgtacttgacgaaa
ttccgcctcattcatgagctgtatcttggaagcggcgacctgaacgtgcttacagaatgc
tttgacctgctggaatccaggcagcttcttgctgacgccgaagatctgctgcatgataca
gcggaacgtttcaatcagttggaacattacgagtccgccgctttcttttaccgcaggctg
atgaatattaaaaagaagcttgccgagcagcgttttcaatag

DBGET integrated database retrieval system