KEGG   Bacillus subtilis subsp. subtilis 168: BSU02830Help
Entry
BSU02830          CDS       T00010                                 

Gene name
ycdF
Definition
(RefSeq) glucose 1-dehydrogenase 2
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU02830 (ycdF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BSU02830 (ycdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 938377
NCBI-ProteinID: NP_388165
Pasteur: BG12761
BSORF: BG12761
UniProt: P80869
Position
305658..306434
Genome map
AA seq 258 aa AA seqDB search
MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGADETLEIIKQNGGKAV
SVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHEMSLEDWQRVIDVNVTG
TFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADK
GIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPEEVAAAAAWLVSEEASYVT
GATLFVDGGMTLYPSQLE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagatttaaccggaaaaacagcgattgtgacagggtcttcaaaaggaatcggg
aaagccattgcggaacggttcggaaaggagaaaatgaatgttgttgtaaattaccacagc
gacccgtctggagcagatgaaactctggaaatcattaagcagaacggagggaaagccgtc
tcagttgaggcggacgtgtcaaaagaagaggggattcaggcgctcttggacacagcttta
gagcatttcggcacgctcgatgtgatggtaaacaactccggttttaacggcgttgaggcg
atgccgcatgagatgagtcttgaagattggcagagagtgattgatgtcaatgttaccgga
acctttctgggagcgaaagcagcacttaaccacatgatgaaaaacaatatcaagggcaat
gtgctgaatatctcaagtgttcatcagcagattccgcgccctgtaaacgttcagtattcc
acatccaaaggcggcatcaagatgatgacggaaacgctggcgctcaattatgcggataag
ggaatccgcgtcaatgcgatagcgcccggcaccattgccacagaatcaaatgttgatacg
aaaaaggaagagagcaggcaaaaacaattgaaaaaaatcccgatgaaagccttcggaaag
cctgaagaagtggcggcagcagcagcttggctcgtatctgaggaagcaagctatgtgacc
ggcgcaacacttttcgtcgacggcggaatgacactttatccatctcagcttgaatag

DBGET integrated database retrieval system