KEGG   Bacillus subtilis subsp. subtilis 168: BSU02850
Entry
BSU02850          CDS       T00010                                 

Symbol
adcA
Name
(RefSeq) zinc transport system zinc-binding lipoprotein AdcA
  KO
K09815  zinc transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02850 (adcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02850 (adcA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter
    BSU02850 (adcA)
SSDB
Motif
Pfam: ZnuA SLATT_6 RPN6_N DUF92
Other DBs
NCBI-GeneID: 938370
NCBI-ProteinID: NP_388167
Pasteur: BG12763
BSORF: BG12763
UniProt: O34966 A0A6M4JCJ2
Structure
Position
308332..309291
AA seq 319 aa
MFKKWSGLFVIAACFLLVAACGNSSTKGSADSKGDKLHVVTTFYPMYEFTKQIVKDKGDV
DLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAEKSMGQGHAVFVNASKG
IDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEK
NSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEYGLKQVPIAGLSPDQEPSA
ASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTEVLNTLEGLSKEEQDKGLGY
IDIMKQNLDALKDSLLVKS
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtttaaaaaatggagcggtttgtttgtgattgcagcgtgctttttattagttgcagca
tgcggcaactcatcaacaaaagggtcggcggattcaaagggtgataaactgcacgttgtc
acaacgttctacccgatgtatgaattcacaaaacaaattgtaaaagacaaaggcgatgtg
gatctgttaatcccatcttccgttgaaccgcatgattgggaaccgacgccgaaagacatt
gccaacattcaggatgctgatttgttcgtttataatagtgaatacatggagacatgggtt
ccgtcagctgaaaaaagcatgggccaaggccatgccgttttcgttaatgcaagcaaaggc
attgatttaatggaaggctctgaagaagaacacgaagagcatgatcatggggagcatgag
cacagtcatgcaatggaccctcacgtatggcttagccctgttctggcacagaaggaagtt
aaaaatattacggctcaaatcgtgaagcaggacccggataacaaagaatactatgagaaa
aatagtaaagaatatattgcaaaactgcaggatcttgataaactatatcgtacaaccgca
aaaaaagcggagaaaaaagaatttatcacgcagcatacagcttttggctatctggcaaaa
gaatacggcttgaagcaggttccgattgcagggctttcacctgaccaagaaccgagcgca
gccagcttggcaaagctgaaaacatatgccaaagaacataatgtaaaagttatttacttt
gaagaaattgcatcctcaaaggtcgcagatacgctcgccagtgaaatcggcgcgaagaca
gaagtgctgaatacactggaaggcttgagcaaagaagaacaggataaaggtttagggtat
atcgacattatgaaacaaaacctcgatgccctgaaagattcactattggttaaatcataa

DBGET integrated database retrieval system