KEGG   Bacillus subtilis subsp. subtilis 168: BSU02860
Entry
BSU02860          CDS       T00010                                 

Symbol
adcC
Name
(RefSeq) zinc transport system ATP-binding protein AdcC
  KO
K09817  zinc transport system ATP-binding protein [EC:7.2.2.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02860 (adcC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02860 (adcC)
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.20  ABC-type Zn2+ transporter
     BSU02860 (adcC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter
    BSU02860 (adcC)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N NTPase_1 SbcC_Walker_B AAA_29 Pilin DUF1477 AAA_23 RsgA_GTPase Rad17 MeaB
Other DBs
NCBI-GeneID: 938374
NCBI-ProteinID: NP_388168
Pasteur: BG12764
BSORF: BG12764
UniProt: O34946 A0A6M4JCQ8
Position
309347..310042
AA seq 231 aa
MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTLIKVMLGMLKPWEGTV
TISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKGKWFKRLNEEDHLEVEK
ALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDEPTTAVDYDSRKGFYEFM
HHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCLTWNSCDELF
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaatctcgtctcattgaaagatatcgttttcggctattcccatacgcctgttttagat
aaagtatcacttgatattgaaagcggtgagttcgtcggcatcactggaccaaacggcgcc
tctaaatcgacgctcataaaggtaatgctcggcatgctgaaaccgtgggaaggcacagtg
acgatcagtaaaaggaatacagaagggaaacgcctgaccatagggtacgtcccgcagcaa
atttcttcatttaatgccggatttccgagcacggtgctggagcttgttcagtcaggccgc
tatacaaaagggaaatggtttaaacgtttaaatgaagaagatcatcttgaagtagaaaaa
gcattgaaaatggtggaaatgtgggacctccgccatcgtaaaatcggtgatttatcaggc
ggacagaaacagaaaatctgtatcgccagaatgctcgccagcaacccggatctgctgatg
ctggacgaaccgacgacagctgttgattacgacagcagaaaaggattttacgaatttatg
catcatctcgtgaaaaatcacaaccgcacagttgtgatggttactcacgaacaaaacgaa
gtacagcaatttttagataaagtgattcgattagagagaggagaaaaaggcggatggaaa
tgtttgacttggaattcatgcgacgagcttttctag

DBGET integrated database retrieval system