KEGG   Bacillus subtilis subsp. subtilis 168: BSU02880Help
Entry
BSU02880          CDS       T00010                                 

Gene name
yceB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-GeneID: 938371
NCBI-ProteinID: NP_388170
Pasteur: BG12766
BSORF: BG12766
UniProt: O34504
Position
complement(310880..311875)
Genome map
AA seq 331 aa AA seqDB search
MIHLSILDQAPVSKGESPVTTLQHSVELAQLSEQWGYKRYWFAEHHSTKGLASTAPEIMI
ARIAAQTNTIRVGSGGVLLPQYSPFKVAETFRQLEALYPNRIDLGVGRSPGGTTKTRLAL
TDGVKKSLTEFNRQLQDVSYFLTDSLPPDHPYAGIKAAPLIGTAPELWVLGLGENSARRA
AHQGIGYVFGHFINPERGENAFRIYRESFRPSAHFSNPSALFTIFVICAKTDEEAEELAL
SQDLWLLRVGKGLDSRVPSIEEAKAHPYTASDKKLIEENRKRMVIGSPTTVKQQLLDLTG
CYETNEIMVLCNVFDFEAKKESYERLAELFL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgattcatttaagcatacttgatcaggcacctgtttctaaaggagaaagccctgtgaca
actctccagcattcggttgagcttgcccaattaagcgaacagtggggctataagcgttat
tggtttgccgagcatcacagcacgaaaggactggcaagcacagcgcctgaaatcatgatc
gcccgcatcgcagcacagacaaacaccattcgtgtcggatcaggcggcgtgcttctgccc
caatacagcccatttaaagtggctgaaacctttcgccagcttgaggccctgtatccaaac
cggattgacctcggcgtcggtcgctcccccggcggcacgacaaaaaccagacttgcatta
acggacggggtgaaaaaaagcttaaccgaatttaacagacagctgcaggatgtctcttat
tttctaacagattcccttcctcccgaccatccgtatgccggaatcaaagcggcgcccctt
attggtacggcacccgagctatgggtgctcggtcttggtgaaaacagcgcaagacgcgcg
gcgcaccaggggattggatatgtatttgggcatttcattaatcccgagcgaggagaaaat
gcattccgcatctaccgggaaagctttcggccctcagcccatttttcgaatccatccgca
ctgtttacgatttttgtcatttgcgcaaaaacagatgaagaggcagaagaactcgcatta
agccaggatctgtggcttcttcgcgtcggaaaaggcttggacagccgcgtgccaagcatc
gaggaagcgaaagctcatccctatacagcgtccgataaaaaactcatagaagaaaacaga
aagcggatggtgatcggttctcccaccactgtcaaacaacagctgttagacctcacaggc
tgctacgaaacaaatgaaatcatggttctgtgcaatgtgtttgattttgaggcgaaaaaa
gaatcttatgagcgccttgccgaattgtttctataa

DBGET integrated database retrieval system