KEGG   Bacillus subtilis subsp. subtilis 168: BSU02890
Entry
BSU02890          CDS       T00010                                 

Symbol
yceC
Name
(RefSeq) stress response protein SCP2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TerD Tcf25
Other DBs
NCBI-GeneID: 938372
NCBI-ProteinID: NP_388171
Pasteur: BG12767
BSORF: BG12767
UniProt: P81100 A0A6M3ZAA8
Position
312159..312758
AA seq 199 aa
MAISLEKGQRIDLTKGKAGLSKLMVGLGWDPVSSGGGFFSKLLGGGGPNIDCDASVLMLE
NGKFTDKKNLIYFGNLKSRCGGVQHTGDNLTGDGAGDDEQIMIDLDKVPGNIDKLVFVVN
IYDCVRRKQDFGMIQNAFIRVVDQSNHEEMLKYNLRDNYAGRTSLITAEIYRSGSEWKFA
AVGEGTNDTRLEDIISRYV
NT seq 600 nt   +upstreamnt  +downstreamnt
gtggcaatttctttagaaaaaggtcaacgaattgatttaacaaaaggaaaagccggtctg
tcaaaattgatggtcggtctcggctgggacccagtgtcctcaggcggaggattcttcagc
aaactgcttggcggaggcggtccgaatatcgactgtgacgcttcagtgctgatgctggaa
aacggaaaattcaccgataagaaaaacctgatttatttcggcaacctgaaaagccgctgc
ggcggtgtacagcatacaggcgacaacctgacgggtgacggtgcgggcgatgacgagcaa
attatgatagatttagataaagtgcctggaaacatcgataagcttgtatttgtagtgaac
atttacgattgtgtcagaagaaaacaagatttcggcatgattcaaaatgcgtttatccgc
gtagttgatcaatctaatcacgaggaaatgctcaagtacaatttgagagacaattacgcc
ggcagaacaagcctgattacagcagaaatctaccgcagcggcagtgagtggaagtttgcg
gcggtcggtgaaggcacaaacgatacgagattagaagatattatcagtcgatacgtataa

DBGET integrated database retrieval system