KEGG   Bacillus subtilis subsp. subtilis 168: BSU02900Help
Entry
BSU02900          CDS       T00010                                 

Gene name
yceD
Definition
(RefSeq) general stress protein 16U
  KO
K05795  tellurium resistance protein TerD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU02900 (yceD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD
Motif
Other DBs
NCBI-GeneID: 938364
NCBI-ProteinID: NP_388172
Pasteur: BG12768
BSORF: BG12768
UniProt: P80875
Position
312780..313361
Genome map
AA seq 193 aa AA seqDB search
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPND
FIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQ
NFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYRHNGEWKFSAIGSGYQGG
LARIATDYGLQVG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttcattggcaaaaggacaaaaagtagatttaacaaaaacaaatccgggtctt
tcaaaggttgttgtcggtttaggctgggatacgaacaagtatgacggcgggcacgacttt
gatcttgactcaagtgtgtttctgttagacgccgcgggcaaatgcgcgtcaccaaacgac
tttattttctacaaccagcttgaaggcggcaacggttcagtcgttcattcaggcgacaac
ctgactggtgctggcgaaggcgacgatgagaatgtaaaagtaaatctcagcgctgtaccg
gcaaacattgataaaatctcatttgttattaccattcacgatgcagaagcgcgcagccaa
aactttggacaagtatcaaacgcgtttgtccgcatcgtaaatgaagaaacaaatgaagag
ctcatccgttacgatcttgcagaagatttctctattgaaacggcaatcattgcaggggag
ctttacagacataacggcgagtggaaattctcagcaatcggctcaggctaccaaggcggc
cttgcccgcattgcaacagactacggtttgcaagtcggttaa

DBGET integrated database retrieval system