KEGG   Bacillus subtilis subsp. subtilis 168: BSU02900
Entry
BSU02900          CDS       T00010                                 

Symbol
yceD
Name
(RefSeq) general stress protein 16U
  KO
K05795  tellurium resistance protein TerD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU02900 (yceD)
SSDB
Motif
Pfam: TerD
Other DBs
NCBI-GeneID: 938364
NCBI-ProteinID: NP_388172
Pasteur: BG12768
BSORF: BG12768
UniProt: P80875 A0A6M4JF58
Position
312780..313361
AA seq 193 aa
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPND
FIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQ
NFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYRHNGEWKFSAIGSGYQGG
LARIATDYGLQVG
NT seq 582 nt   +upstreamnt  +downstreamnt
atgacaatttcattggcaaaaggacaaaaagtagatttaacaaaaacaaatccgggtctt
tcaaaggttgttgtcggtttaggctgggatacgaacaagtatgacggcgggcacgacttt
gatcttgactcaagtgtgtttctgttagacgccgcgggcaaatgcgcgtcaccaaacgac
tttattttctacaaccagcttgaaggcggcaacggttcagtcgttcattcaggcgacaac
ctgactggtgctggcgaaggcgacgatgagaatgtaaaagtaaatctcagcgctgtaccg
gcaaacattgataaaatctcatttgttattaccattcacgatgcagaagcgcgcagccaa
aactttggacaagtatcaaacgcgtttgtccgcatcgtaaatgaagaaacaaatgaagag
ctcatccgttacgatcttgcagaagatttctctattgaaacggcaatcattgcaggggag
ctttacagacataacggcgagtggaaattctcagcaatcggctcaggctaccaaggcggc
cttgcccgcattgcaacagactacggtttgcaagtcggttaa

DBGET integrated database retrieval system