KEGG   Bacillus subtilis subsp. subtilis 168: BSU02910Help
Entry
BSU02910          CDS       T00010                                 

Gene name
yceE
Definition
(RefSeq) hypothetical protein
  KO
K05795  tellurium resistance protein TerD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU02910 (yceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD
Motif
Other DBs
NCBI-GeneID: 938368
NCBI-ProteinID: NP_388173
Pasteur: BG12769
BSORF: BG12769
UniProt: O34384
Position
313396..313974
Genome map
AA seq 192 aa AA seqDB search
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLD
FVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQ
NFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYRHGGEWKFNAIGSGFSGG
LAALCRNYGLQV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaattatcaaaaggacagcgcattgatttaacaaaaacaaatccgggactg
actaaagcggtgatcggcttaggctgggatacaaacaagtactccggcggacacgatttt
gacctggatgcttcggcctttttagttgatgcgcatgataactgcgtaaatgatctcgat
ttcgtcttctataataaccttgaacatccgagcggcggtgtcatccatacgggtgacaac
cgcacgggtgagggcgacggagatgatgagcagattatcgttgatttctcaaaaatccct
gctcacattgagaaaatcggcatcacagtgaccattcacgacgctgaagcacgcagccaa
aactttggacaagtttccaatgcatttgtccgcgttgtggatgaagaaacgcagaatgag
cttcttcgcttcgatttgggagaagacttctccattgaaacagctgttgtcgtttgtgag
ctttacagacacggcggcgagtggaaattcaatgcaatcggcagcggattttccggcggg
ctggctgcattgtgccggaattacggtttgcaagtgtaa

DBGET integrated database retrieval system