KEGG   Bacillus subtilis subsp. subtilis 168: BSU02920
Entry
BSU02920          CDS       T00010                                 

Symbol
yceF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TerC DUF475 PspB
Other DBs
NCBI-GeneID: 938369
NCBI-ProteinID: NP_388174
Pasteur: BG12770
BSORF: BG12770
UniProt: O34447 A0A6M3Z7R5
Position
314025..314798
AA seq 257 aa
MDFLHHILSTYASFFDWKMWGEVLTDPVSWGLIGSLVVLEGLLSADNALVLAVMVKHLPE
KQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAWLVIKHFWIGEKEEEAD
GMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMRT
VAKVFLVLIDKIPELENTAFVLIGIIALKMAGSAFHYEMPHSVFFIIIIAAFAVTLIIHY
INKQKQVREQTAASKEE
NT seq 774 nt   +upstreamnt  +downstreamnt
ttggactttttacatcatattttgtctacgtatgcttcatttttcgattggaaaatgtgg
ggggaagttctgactgatcctgtttcctggggtttgatcggttcccttgttgttctggaa
ggccttttatcggccgataacgcgcttgttcttgcggtcatggttaaacacctgccggaa
aaacagcggaaaaaagcgttaacgtatggtttgtttggagcttatattttcaggtttatt
ttcatcgggctcggtatgcttctcattaaattctggtggatcaaggtgcttggcgcgctt
tacctggcttggctcgtcattaagcacttctggataggcgaaaaagaagaggaagcggac
ggcatgaagaaaaactcttggatggtccgcacgttcgggatcttctgggcgactgtcatt
tcagtagaattaatggatcttgccttctctgtggacagcatcctggccgcgtttgcagta
tctgaaaaagtatgggtgcttctgattggcggtatgcttggtattttaatgatgcgtaca
gtggcaaaagtgttccttgtgctgattgataaaattcctgagctggaaaacacagcattc
gtcttaatcggcattatcgcgctgaaaatggcggggagcgctttccattacgaaatgccg
cactctgtattcttcattatcattatcgctgcatttgcggtaacattgatcattcactac
atcaataaacaaaagcaggtgcgcgaacaaacagccgcttcaaaagaagaataa

DBGET integrated database retrieval system