KEGG   Bacillus subtilis subsp. subtilis 168: BSU02930Help
Entry
BSU02930          CDS       T00010                                 

Gene name
yceG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG_bac
Motif
Other DBs
NCBI-GeneID: 938361
NCBI-ProteinID: NP_388175
Pasteur: BG12771
BSORF: BG12771
UniProt: O34809
Position
314883..316496
Genome map
AA seq 537 aa AA seqDB search
MRQEELTIHKALPADGDWKSLLFQPLPERDHYETAQGLSFSRLAGQILGTPIDETDYYNE
LYELSVNDRITILSETLDKTIEPETFQKLQHIHSINQKEKGLSVSRFVAFLDGEKLIAKH
SNPLMHRHLRKALMTLLHTFADSHEKGLNHPDFRRVLLDVSKFSLNHLNPWLEKTDIERE
MPKVVWYGDATKSQLYFLYYLMLVGCDVLLFHPAGTDQLALVDPKQELGFTEKLPDVSEL
QPFPKEKPDRKSTVAYRSTKEIEHVLNHEESMLYKPWQFRDHTPVSVTLKTTYDELFLIT
KERAFIRPNFKADKHSIEIPNVFAKIMGVSKDNKEYWNRLHTLADYQETEMVRSFPFTEE
IKSNYQFHYSHALDQEGNIDPDKLMASNVWQYKQLPAGVQTAIAKTISRMCRYPRLKALH
QEQVKDVQIYLFKQTTNLPANLLKLIQMFDYAQTVPKLVLYHTEMSGGLTRSDAAALLFL
NEIGIDIIIYNPPGHQDIEQFIEEDQYDIHWLDDMVFQQDYKEPSLVKRLFRTITQK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagacaagaagaactaaccattcataaagcacttccggctgatggcgattggaaaagc
ctgctgtttcagccattgccggagcgggatcactatgaaactgcacaaggcctttctttt
tctcgtcttgccggtcagatattgggcacgcctattgatgagacggactactataacgag
ctgtatgagctgtctgtaaacgaccgcataacgattttgagtgaaacgcttgataaaaca
atcgaaccggaaacatttcaaaagcttcagcatattcattccatcaatcagaaagaaaaa
gggctgtcagtcagccgctttgttgcctttctggacggggaaaagctgattgcgaagcac
tcaaatcccttgatgcaccgccatttaagaaaagcgttgatgacgcttttacataccttt
gcggacagtcatgaaaaggggctgaatcatcctgattttcgcagagtgctgcttgatgtc
tcgaagttttccttaaaccatctgaacccttggctggaaaaaaccgatatagagcgggag
atgccgaaggttgtttggtatggagatgcgacgaaaagccagctctatttcttatattat
ctgatgctggtcggctgtgatgtactgctgttccatccggcgggaacggatcagctggcg
cttgtcgacccgaagcaggagctcggttttacggaaaagctcccggatgtttcggagctt
cagccgtttccgaaagaaaaaccagaccggaaatcaacagtggcttaccgctcaacaaag
gaaattgaacatgtgctgaatcacgaggaatccatgctatataagccgtggcagttcaga
gatcacacaccggtgtccgttacgctgaaaacgacctatgatgaattgtttttaatcacg
aaagaacgcgcctttattcggccgaatttcaaagctgataaacattccattgagattccg
aatgtattcgccaaaattatgggcgtgtcgaaagacaataaggaatattggaacaggctt
catactctagcggattatcaggaaacagaaatggtcagaagctttccatttacagaagaa
ataaagtcgaactatcaatttcactacagccacgcacttgatcaagaagggaacattgat
ccggacaagctgatggcaagcaatgtgtggcagtacaaacagctgccggcgggcgttcag
actgccattgccaaaacgatttcgagaatgtgcaggtacccgcggcttaaagccttgcat
caggaacaagtcaaggatgttcaaatctatttgtttaaacaaacaacaaacctgcctgct
aatctgctgaaattgattcaaatgttcgactatgcgcaaaccgttccgaaactcgtttta
tatcatacggaaatgagcggcggactcacgcgttcggatgctgccgccctgctgttcctg
aatgaaatcggaatcgatatcatcatttataatccgcccggacaccaagatattgagcag
tttattgaagaggatcagtatgatatccactggctggatgacatggtgtttcagcaggac
tacaaagagccttcgcttgtgaaaaggctcttcagaaccattacccaaaaataa

DBGET integrated database retrieval system