KEGG   Bacillus subtilis subsp. subtilis 168: BSU02940Help
Entry
BSU02940          CDS       T00010                                 

Gene name
yceH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TelA DASH_Spc34
Motif
Other DBs
NCBI-GeneID: 938366
NCBI-ProteinID: NP_388176
Pasteur: BG12772
BSORF: BG12772
UniProt: O34833
Position
316512..317603
Genome map
AA seq 363 aa AA seqDB search
MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLAQQIDVKNQMELLEYGKEPAVE
ISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKGLMAKIFKRGGSMIEKI
FKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYYMELEKYVVAGQMKLEEM
QSILPSYEEKAASGNQLAQMQLDTLRNGIQALEERVYDLDMARMVALQTAPQIRLLQRGN
AKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSELDRRTNEMLKRNAENISSQS
VEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKRLREDGARRIAQLQDNIKKAA
LQQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaaaatcaaaatccgcttgttctcgataaaaatgaagagatttcccagcaa
aaagctgacgatatccgtcttcagctccgtcaggaaccagaagtgaagcggcttgctcaa
caaattgacgtcaaaaaccaaatggagctgcttgagtacggcaaggagccggccgttgaa
atatccaagttctctgaccgcatcttggggatgatgaaaacaacaagcgtgacagactcc
ggcacaatgctgactcagcttgggaaaatcatggaccgcttcgacaaaaatgattttgat
gagccaaagggattaatggcgaaaattttcaaacgcggcggcagcatgattgaaaaaatc
tttaaaaagtatcagacgcttggcggagagattgaaaaaatccacgttgagatttcaaaa
tacaaagatgagatgacgaagacgaactacacgctcgatgaaatgtatgaaaacaatatc
aaatactatatggagcttgaaaaatacgtcgttgccgggcagatgaaactggaagagatg
cagtcgatccttccttcatatgaggaaaaagcggcaagcgggaaccagctggcgcaaatg
cagctcgatacgttgcgcaacggcattcaggcgcttgaggaacgggtgtatgatcttgac
atggcacggatggtggcgcttcaaaccgcacctcaaatccgtctcctgcagcgaggaaat
gcaaagctgatcgggaaaatcaactccgcgtttatcattaccattccgattttcaaaaac
ggcattattcaggctgttacggtaaagcggcaaaagcttgtggctgattccatgagcgag
cttgaccgccggacaaacgagatgctgaaacgaaatgctgaaaacatctcgagccaaagt
gttgaaattgcgagaatggccggcagaccgagcatagatattgaaacgattgaatcgtct
tggaacacgattgtcagcggcatgcaggaaacaaaacaaatcgaagaagaaaacaagcgc
ctccgcgaagacggcgcgagacgaattgcccagcttcaggataatattaaaaaagcagca
ttgcagcaataa

DBGET integrated database retrieval system