KEGG   Bacillus subtilis subsp. subtilis 168: BSU02950Help
Entry
BSU02950          CDS       T00010                                 

Gene name
yceI
Definition
(RefSeq) niacin/nicotinamide transporter NaiP
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02950 (yceI)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    BSU02950 (yceI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 938365
NCBI-ProteinID: NP_388177
Pasteur: BG12773
BSORF: BG12773
UniProt: O34691
Position
317725..318927
Genome map
AA seq 400 aa AA seqDB search
MGKQQPISQRKLLGVAGLGWLFDAMDVGILSFIIAALHVEWNLSPEEMKWIGSVNSIGMA
AGAFLFGLLADRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLILRFVIGMGLGGELPVA
STLVSEAVVPEKRGRVIVLLESFWAVGWLAAALISYFVIPSFGWQAALLLTALTAFYALY
LRTSLPDSPKYESLSAKKRSMWENVKSVWARQYIRPTVMLSIVWFCVVFSYYGMFLWLPS
VMLLKGFSMIQSFEYVLLMTLAQLPGYFSAAWLIEKAGRKWILVVYLIGTAGSAYFFGTA
DSLSLLLTAGVLLSFFNLGAWGVLYAYTPEQYPTAIRATGSGTTAAFGRIGGIFGPLLVG
TLAARHISFSVIFSIFCIAILLAVACILIMGKETKQTELE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacaacagcctatatcccagcgtaaactgctgggcgtcgccggtttggggtgg
ctgtttgatgcaatggatgtcggaatattatcgtttattatcgccgcgctccatgtagag
tggaatctgtcgcccgaagaaatgaaatggatcggaagcgtcaattccatcggcatggct
gcgggtgcgtttttgtttggtttgcttgctgatcgaatcggccgcaaaaaagtgttcatc
atcacccttttatgcttttccatcggaagcggcatttccgcttttgtgacgagcttatcg
gcatttctaatccttcgtttcgtgattggtatgggacttggcggcgagcttccagtcgct
tcaacactcgtttcggaagcggttgtgcctgaaaagcggggcagagtgattgtgcttttg
gaaagcttttgggccgtgggctggctcgcagcggccttgatttcttactttgtgatacca
agcttcggctggcaggctgcccttctgttaactgcgctgactgctttttatgcgctgtac
ctgcggacgagtctacctgattcgccgaaatatgaatcgctttctgccaaaaagaggtcg
atgtgggagaatgtaaaaagcgtctgggcaagacagtatatacggccgacggtgatgctg
tcgatcgtttggttctgtgtggtgttttcttattacggcatgttcctatggctcccgagt
gtcatgctgctgaaaggcttcagcatgattcaaagctttgaatatgtcctgctgatgacg
cttgctcagctacctggctatttctctgccgcatggctgattgaaaaagcgggccggaag
tggatactcgtcgtttacttgattggcacagcaggaagcgcctatttcttcggaacggcg
gattccttaagtcttctgcttacggctggagtgctgttatcgtttttcaatctcggtgcg
tggggcgtgctgtatgcttataccccggagcaatacccgactgcgattcgagcaacaggt
tcaggaacgacagcagcgtttggaagaatcggcggcatcttcgggcctttgctcgtcgga
accctggcagcccgtcatatttcgttttcggtcatcttttcaatcttttgcattgcaatc
ttacttgcggttgcttgtattttgattatggggaaagaaacgaaacaaactgagctagaa
tag

DBGET integrated database retrieval system