KEGG   Bacillus subtilis subsp. subtilis 168: BSU02960
Entry
BSU02960          CDS       T00010                                 

Symbol
yceJ
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_4 MFS_3 Sugar_tr LacY_symp
Other DBs
NCBI-GeneID: 938363
NCBI-ProteinID: NP_388178
Pasteur: BG12774
BSORF: BG12774
UniProt: O34724 A0A6M4JCK1
Position
complement(319180..320352)
AA seq 390 aa
MNRIWLFFSVMFVIGTDTFLLSPLLPLLQDQFHVSTDLSGWMVSAYALGYALFAFIAGPI
SDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAAFVTPQIWASIPVIVQ
PSQIIKGMGIATAGLAASQMLGLPIGGFLASFTWHTPFFVLSACSLILLLILAAVMPGIR
PSEPLARPSIVNPYRELFSLPKTSVILLAYFLFQTGNFASFSFLGTWLSADYHLTVSQIG
AAMLVLGLGNMLGSLIGSRVSEKLGMFKTLISGMLLMGALYFALPFFPNLFLVEAGFFLT
FFTAGIIFPLMMGVFQSIAPNARGTIASLSNAAMYAGTTVGTSIAGFLYQSTQHFGAVTG
FTAILFILSMTLYQTISKTGKRQSTARAQL
NT seq 1173 nt   +upstreamnt  +downstreamnt
ttgaatcgcatttggcttttcttcagtgtcatgtttgtcattggcacggatacctttttg
ctttcgccgcttctcccccttttacaggatcagtttcatgtctctactgatttgtcaggc
tggatggtcagtgcttatgcactcggttatgcactcttcgctttcattgcaggcccaatc
tcagaccggctgaacaggaaaacagtcatgctgtggggacttgcaggctttatcgtatcc
acatttttatgcggcatcgctccctcttttgccgccatgtgcctgttccgttttgccgca
ggcgttagcgctgcgtttgtgacgcctcaaatttgggcgtccatcccagtcattgtccag
ccttctcagatcataaaaggcatggggattgcgacagcaggtttggccgcttcacaaatg
ctcggacttcctattggagggtttctcgcttcctttacatggcatacgccatttttcgtt
ttgtcagcgtgctcgcttattcttctattgatcctggcggcggtcatgcctggcatccgg
ccttctgaaccattggcgcgcccatcaattgtcaacccctatcgggagcttttttcattg
ccgaaaacatcggtcattctgcttgcctattttctgtttcaaaccggaaacttcgcatcg
ttcagctttctgggtacttggctttccgcggattatcatttaaccgtgtcacaaattggc
gcagctatgcttgtactcggactgggaaatatgctcgggagccttatcggcagccgggtt
tcagaaaagctgggcatgtttaaaacactgatcagcgggatgctgctaatgggcgctctc
tatttcgctcttccgttctttccaaacttgtttttagtagaagccggcttttttctcacg
ttctttacagctggcatcatctttccgttaatgatgggtgtctttcaatccattgcacca
aatgcgcgaggaaccatcgcttccctttccaatgccgctatgtatgccggaaccactgtc
ggtacaagtattgcaggttttttatatcaaagcacacagcatttcggagctgtcacagga
tttactgccattctgttcatactttctatgacgctctaccagacaatcagtaaaaccggg
aaacgccaatccacagcccgggcgcaattgtaa

DBGET integrated database retrieval system