KEGG   Bacillus subtilis subsp. subtilis 168: BSU02970Help
Entry
BSU02970          CDS       T00010                                 

Gene name
yceK
Definition
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 HTH_24 MarR_2 HTH_27 HTH_23
Motif
Other DBs
NCBI-GeneID: 938357
NCBI-ProteinID: NP_388179
Pasteur: BG12775
BSORF: BG12775
UniProt: O34464
Position
complement(320421..320723)
Genome map
AA seq 100 aa AA seqDB search
MYYSFMTMKQSDDQIRAQIFKALSDESRLAIIRTLYVSGKELSCGEVGEKCNIVKTTASY
HFKTLREAGLTATRKDSRTKYVSLREDTFQTYLPGFLETL
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgtattatagtttcatgactatgaaacaatcagatgatcaaatcagagcgcaaattttt
aaagcactgtctgatgaatcaaggcttgccattattcgtacgctttatgtcagcggaaaa
gaactcagctgcggtgaagtaggtgaaaagtgcaatattgtcaaaaccacggcatcttat
cattttaaaacgctgcgtgaagcgggattgacggcaacccggaaagattcgcggacaaaa
tacgtcagtctgcgtgaagacacatttcaaacatacctgcctggctttttggaaaccctc
taa

DBGET integrated database retrieval system