KEGG   Bacillus subtilis subsp. subtilis 168: BSU02980Help
Entry
BSU02980          CDS       T00010                                 

Gene name
opuAA
Definition
(RefSeq) glycine/betaine ABC transporter ATP-binding protein
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:7.6.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02980 (opuAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02980 (opuAA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     BSU02980 (opuAA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208]
    BSU02980 (opuAA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CBS AAA_22 AAA_16 AAA_21 G-alpha AAA_29 RsgA_GTPase Zeta_toxin ABC_ATPase APS_kinase AAA_18 Adeno_IVa2 AAA_14 AAA_33 AAA_23 AAA_PrkA AAA_24 AAA_30 SbcCD_C ATPase_2 Peptidase_C14 AAA_28 LPD23
Motif
Other DBs
NCBI-GeneID: 938362
NCBI-ProteinID: NP_388180
Pasteur: BG11370
BSORF: BG11370
UniProt: P46920
Position
321013..322269
Genome map
AA seq 418 aa AA seqDB search
MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGSTVGVNQADFEVYDGE
IFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQLREVRRKKISMVFQKF
ALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFEHQYPDQLSGGMQQRVGL
ARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKTIIFITHDLDEALRIGDRI
VLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTAGHIMKRAETVRIDKGPRVA
LTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSLQDILNTEFTTVPENTYLTEI
FDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEYINAEGTNEQTQDPSAQEVK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagatgagaaaccaattaagataaaagtcgagaaagtctctaagatttttggg
aaacaaacaaagaaggcagttcaaatgcttgccaacggaaagacaaaaaaagagatcctg
aaagcaaccggatcaaccgttggggttaatcaggcagattttgaagtatatgatggtgag
atatttgtcatcatgggtctatcagggagcggtaaatcaactttagtacggatgttaaac
cggcttattgaaccgactgccggaaatatttacattgatggtgacatgataacaaatatg
tcaaaagaccagctccgggaagtccgccggaaaaaaatcagcatggtcttccaaaagttc
gctctgtttccgcacagaacgatacttgaaaacacagaatacggactggagcttcaaggt
gtagacaaacaagagcggcagcaaaaagcgcttgagtctcttaagctcgttggactggaa
ggatttgaacaccaatatcccgaccagctttccggcgggatgcagcagcgtgtcggcctt
gcccgcgcgttgacgaatgacccggacatccttctgatggacgaagcgttcagtgcgctc
gatccactgattcgtaaagatatgcaggatgagcttcttgatcttcacgataatgtcgga
aaaacaattatctttattacgcatgacttggacgaagcgttgcggatcggcgacagaatt
gtcctaatgaaggacggcaacatcgttcaaatcggcacgcctgaagaaatcctgatgaat
ccatctaacgaatatgttgagaaattcgtcgaagatgttgatttgtctaaagtcctcaca
gcaggccacattatgaaacgcgctgaaacagtgcggattgataaagggcctcgcgtagca
ttgacactgatgaaaaaccttggaatttcttcaatttatgcagtggataaacaaaagaaa
ttattaggtgttatctatgcgtctgatgcgaaaaaagcggctgagtctgatttgtcactt
caagacatcttgaatacagaatttacgactgtaccagagaatacgtatctgactgagatt
tttgacgttgtgtccgatgcgaatattccaattgcggttgtggatgagaagcaaagaatg
aaaggaattgtcgtaagaggcgcgctgattggcgcacttgccggcaataacgagtatatc
aatgctgaaggcactaacgaacaaacacaagatccttctgcacaggaggtgaaataa

DBGET integrated database retrieval system