KEGG   Bacillus subtilis subsp. subtilis 168: BSU02980
Entry
BSU02980          CDS       T00010                                 

Symbol
opuAA
Name
(RefSeq) glycine/betaine ABC transporter ATP-binding protein
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:7.6.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02980 (opuAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02980 (opuAA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     BSU02980 (opuAA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    BSU02980 (opuAA)
SSDB
Motif
Pfam: ABC_tran CBS AAA_22 AAA_16 Zeta_toxin G-alpha AAA_29 RsgA_GTPase ABC_ATPase APS_kinase Adeno_IVa2 AAA_14 AAA_18 AAA_33 AAA_30 AAA_23 AAA_PrkA ATPase_2 SbcCD_C
Other DBs
NCBI-GeneID: 938362
NCBI-ProteinID: NP_388180
Pasteur: BG11370
BSORF: BG11370
UniProt: P46920 A0A6M3Z771
Position
321013..322269
AA seq 418 aa
MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGSTVGVNQADFEVYDGE
IFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQLREVRRKKISMVFQKF
ALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFEHQYPDQLSGGMQQRVGL
ARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKTIIFITHDLDEALRIGDRI
VLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTAGHIMKRAETVRIDKGPRVA
LTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSLQDILNTEFTTVPENTYLTEI
FDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEYINAEGTNEQTQDPSAQEVK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagtgtagatgagaaaccaattaagataaaagtcgagaaagtctctaagatttttggg
aaacaaacaaagaaggcagttcaaatgcttgccaacggaaagacaaaaaaagagatcctg
aaagcaaccggatcaaccgttggggttaatcaggcagattttgaagtatatgatggtgag
atatttgtcatcatgggtctatcagggagcggtaaatcaactttagtacggatgttaaac
cggcttattgaaccgactgccggaaatatttacattgatggtgacatgataacaaatatg
tcaaaagaccagctccgggaagtccgccggaaaaaaatcagcatggtcttccaaaagttc
gctctgtttccgcacagaacgatacttgaaaacacagaatacggactggagcttcaaggt
gtagacaaacaagagcggcagcaaaaagcgcttgagtctcttaagctcgttggactggaa
ggatttgaacaccaatatcccgaccagctttccggcgggatgcagcagcgtgtcggcctt
gcccgcgcgttgacgaatgacccggacatccttctgatggacgaagcgttcagtgcgctc
gatccactgattcgtaaagatatgcaggatgagcttcttgatcttcacgataatgtcgga
aaaacaattatctttattacgcatgacttggacgaagcgttgcggatcggcgacagaatt
gtcctaatgaaggacggcaacatcgttcaaatcggcacgcctgaagaaatcctgatgaat
ccatctaacgaatatgttgagaaattcgtcgaagatgttgatttgtctaaagtcctcaca
gcaggccacattatgaaacgcgctgaaacagtgcggattgataaagggcctcgcgtagca
ttgacactgatgaaaaaccttggaatttcttcaatttatgcagtggataaacaaaagaaa
ttattaggtgttatctatgcgtctgatgcgaaaaaagcggctgagtctgatttgtcactt
caagacatcttgaatacagaatttacgactgtaccagagaatacgtatctgactgagatt
tttgacgttgtgtccgatgcgaatattccaattgcggttgtggatgagaagcaaagaatg
aaaggaattgtcgtaagaggcgcgctgattggcgcacttgccggcaataacgagtatatc
aatgctgaaggcactaacgaacaaacacaagatccttctgcacaggaggtgaaataa

DBGET integrated database retrieval system