KEGG   Bacillus subtilis subsp. subtilis 168: BSU02990
Entry
BSU02990          CDS       T00010                                 

Symbol
opuAB
Name
(RefSeq) glycine betaine transport system permease protein OpuAB
  KO
K02001  glycine betaine/proline transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02990 (opuAB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02990 (opuAB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    BSU02990 (opuAB)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938360
NCBI-ProteinID: NP_388181
Pasteur: BG11371
BSORF: BG11371
UniProt: P46921 A0A6M3Z731
Position
322271..323119
AA seq 282 aa
MDRLPRIPLADIIDRFVDWITMTFGGFFDGIANGLAAFVNGIVTGLGFIPSILLTIIFAA
LAWWISTRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIISIVVGVPIGIWASQKET
VRRIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPA
DLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVY
SAVTQLKTGVGVEAGIAIVIVAITLDRITQNIKVKKKSRGNA
NT seq 849 nt   +upstreamnt  +downstreamnt
atggatagactgcctagaatacctttagcagatattattgaccgttttgttgactggatt
acgatgacgtttggcggattcttcgacggaatcgctaacggattggccgcttttgtaaat
ggaattgtcaccggtcttggatttattccatctattttgttaacgattattttcgccgca
cttgcgtggtggatcagtacaaggggaattgcgttatttacgttgattggattcctcctg
atcgattatttaggatattgggacccaatgctgcaaacattggcgcttgttttgacatct
gtgattatttcgattgtggtcggggttccgatcggaatttgggcgtctcagaaagaaacg
gttcgccgtattgtaacgccaattcttgatttaatgcagacaatgcctgctttcgtatat
ctattgccggcgattttcttctttaacatcggtgttgtgccgggtgttgttgcatctgtt
atcttcgcgatgccgccgacaatccgcatgactgttctcggtattaaacaagtgccggcg
gatttgattgaagcgactgaggcattcggttctacaacagctcagcgtttgtttaaagtt
cagctcccgcttgcgacaaaaacgattttggccgggatcaaccagagcatcatgcttgcg
ttatcaatggttgttatcgccgcaatggtcggtgcaccgggacttggttctgaagtatac
agtgccgttacacagctgaaaaccggggtcggagtagaggccggtatcgccatcgttatc
gttgccattaccctggaccgtattactcaaaatattaaagtgaagaagaaaagcaggggg
aatgcctga

DBGET integrated database retrieval system