KEGG   Bacillus subtilis subsp. subtilis 168: BSU03000
Entry
BSU03000          CDS       T00010                                 

Symbol
opuAC
Name
(RefSeq) glycine betaine-binding protein OpuAC
  KO
K02002  glycine betaine/proline transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03000 (opuAC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03000 (opuAC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    BSU03000 (opuAC)
SSDB
Motif
Pfam: OpuAC
Other DBs
NCBI-GeneID: 938354
NCBI-ProteinID: NP_388182
Pasteur: BG11372
BSORF: BG11372
UniProt: P46922 A0A6M4JF68
Structure
Position
323119..324000
AA seq 293 aa
MLKKIIGIGVSAMLALSLAACGSENDENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYD
LNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEI
HTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEW
TKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSAD
ASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcttaaaaaaatcataggcatcggcgtttccgccatgctggcgctctcacttgcggct
tgcggttcagaaaacgatgaaaatgcatccgcagcagaacaagtgaataagaccatcatc
gggattgaccccggttcagggattatgtccctgactgacaaagcgatgaaggattatgac
ctgaatgactggacattgatttcagcgtcaagtgctgcgatgaccgctacgcttaaaaag
tcatacgaccgtaagaaaccgattatcattacaggatggacaccgcactggatgttctcc
agatataagctgaaatatctcgatgatccgaaacaatcttatggcagcgcagaggaaatc
catacgatcacacgcaaaggcttcagcaaagagcagccgaatgccgcaaagcttctgagc
cagtttaaatggacgcaggacgaaatgggcgaaatcatgatcaaggtggaagaaggcgag
aaacctgccaaagttgctgctgagtacgtcaataaacacaaggatcagattgccgaatgg
acaaaaggcgttcaaaaggtgaagggagacaaaatcaaccttgcctatgtggcgtgggac
agtgagattgcaagtacaaacgtcataggcaaagtcttagaagacttgggctatgaggta
acacttactcaggtagaggctgggccgatgtggactgcaattgcgacgggaagtgcggat
gcatccctttccgcatggctgccgaatacccataaagcatacgccgctaaatataaaggc
aaatatgatgatattggcaccagtatgactggtgtgaagatggggcttgttgttcctcaa
tatatgaaaaatgtcaactcaattgaagatttgaagaagtaa

DBGET integrated database retrieval system