KEGG   Bacillus subtilis subsp. subtilis 168: BSU03010Help
Entry
BSU03010          CDS       T00010                                 

Gene name
amhX
Definition
(RefSeq) amidohydrolase AmhX
  KO
K14665  amidohydrolase [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU03010 (amhX)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU03010 (amhX)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M20
   BSU03010 (amhX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 938351
NCBI-ProteinID: NP_388183
Pasteur: BG11789
BSORF: BG11789
UniProt: P54983
Position
complement(324038..325189)
Genome map
AA seq 383 aa AA seqDB search
MQKLSEEMKQTIMDIFEHLHANPEVSWKEYETTSFLKQKLEDLGCRTRTFSDCTGVVGEI
GSGSPVVAVRADIDALWQEVNGTFRANHSCGHDSHMTMALGTLMLLKKQPELPKGTIRFI
FQPAEEKGGGALKMIEEGVLDDIDYLYGVHVRPIQETQNGRCAPSILHGSSQHIEGTIIG
EEAHGARPHLGKNSIEIAAFLVHKLGLIHIDPQIPHTVKMTKLQAGGESSNIIPGKASFS
LDLRAQTNEAMEALIAETERACEAAAAAFGAKIELHKEHSLPAATQNKEAEAIMAEAITE
IIGAERLDDPLVTTGGEDFHFYAVKVPNLKTTMLGLGCGLQPGLHHPHMTFDRNAMFTGI
HILANAVLKTFQKAESLAAANAS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctttcagaagaaatgaaacaaaccattatggacatcttcgagcatctgcac
gcgaaccctgaagtcagctggaaggaatatgagacaacttcatttttgaaacaaaagctt
gaggatttagggtgccggacgcgcacgttttcagactgcaccggggttgtcggcgaaatc
ggctcaggctcacctgttgtagcggtacgcgctgatattgacgcgctgtggcaggaggtt
aacggcacatttcgcgccaaccattcctgcggacacgattcacatatgacaatggcattg
ggcacgttaatgctgctaaaaaaacaacctgagcttccgaagggcacaatccgttttatc
tttcagccggcagaagaaaaaggcggcggcgccttgaaaatgatagaagaaggcgtgctt
gatgatatcgactatttgtatggcgttcacgtccgtccgatccaggaaacacagaacggc
cgctgcgctccttctattctgcacggatcaagccagcacattgagggaacgatcatcggg
gaagaggctcatggcgcccgtccgcacctcgggaaaaacagcattgaaattgcggcattt
cttgtacacaagctcggactcattcatattgacccgcaaatcccgcataccgtcaaaatg
acaaaactgcaagccggcggtgaaagctctaacatcattccaggaaaagcatcgttcagc
cttgatttgcgcgcacagaccaatgaagccatggaggcattaatcgccgaaacagaaaga
gcctgtgaagcggccgccgctgcatttggcgcaaagatcgagctgcacaaagaacacagc
cttcctgcggcaacacaaaataaagaagctgaagcgatcatggcagaagccattacggaa
atcatcggggctgagcggcttgatgacccgcttgtcaccaccggcggcgaggatttccat
ttttacgccgtgaaggtgccgaatctgaaaacaacgatgctcggactaggctgcgggctc
cagccggggctccatcatccgcacatgacctttgacagaaatgcgatgtttaccggcatt
catattttggcgaacgccgtgctcaaaacatttcagaaggcggaatcacttgctgccgct
aacgcttcttaa

DBGET integrated database retrieval system