KEGG   Bacillus subtilis subsp. subtilis 168: BSU03020Help
Entry
BSU03020          CDS       T00010                                 

Gene name
ycgA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcuC Na_H_antiporter ABG_transport CitMHS
Motif
Other DBs
NCBI-GeneID: 938359
NCBI-ProteinID: NP_388184
Pasteur: BG11999
BSORF: BG11999
UniProt: P55908
Position
325339..326772
Genome map
AA seq 477 aa AA seqDB search
MSMPAAETQPKKKRMTFKMPDAYVLLFMIAFICAIASYIVPAGEFDRVTKGDVTTAVPGS
YHSIEQSPVRLISFFTSLQDGMVGSAPIIFLILFTGGTIAILEKTGAINGLIYNVISKFR
TKQLLFICIVGALFSILGTTGIVVNSVIGFIPIGLIVARSLKWDAVAGAAVIYIGCYAGF
NSTILSPSPLGLSQSIAELPLFSGIGLRVVIYICFLLSSIIYIYLYTRKLKKSKDASVLG
TDWFPAAGMGEAGKEEDQSVPFTVRHKLILAVAGLSLVGFLYGALKLGWSDSQMAATFIF
ISVLAGLIGGLAANDIAKTFITGCQSLVYGALIVGMARSISVILENGKLLDTVVNALASL
LDGFSPIAGAIGMYIASALLHFLISSGSGEAVVFIPILAPLADLMGITRQVAVEAVMLGE
GVVNCVNPTSGVLMAVLAASGIPYVKWLRFMVPLALIWFLIGLVFIVIGVMINWGPF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgccagcagccgaaacacagcctaagaaaaaacgtatgacatttaaaatgcct
gacgcctatgtcctcttatttatgattgctttcatttgcgcaatcgcttcatatattgtg
ccggcaggtgaatttgaccgcgtgacaaagggggatgtcacgaccgctgttccgggaagc
tatcattcaattgaacagtctccggtcagattgatcagcttttttacttctctacaggat
ggaatggttggatcagcacccatcatctttctgattttattcacaggcggcaccattgct
attctagaaaaaacgggtgccatcaatggcctgatttacaatgtcatcagcaaattccgc
acaaagcaattattatttatttgtattgtcggcgcattgttctccattctcggaacaacc
gggattgtcgtgaattcagttatcggttttatccccatcggcctcattgtggcacgatcc
ttaaaatgggacgcagtcgcgggagccgctgttatatacatcggctgctacgctggattt
aactccaccatattatcaccgtcaccgctcggtttatcacaatcaatcgcggagctccct
cttttctcaggaatcggcctgcgagttgtgatatacatatgctttttgctgtcttctatt
atttatatctatttgtatacgagaaaattaaaaaaatcaaaagatgccagtgtgttagga
acagattggttccctgcggcaggaatgggcgaagccggtaaagaagaagatcagtcagtg
ccgtttaccgttcgccataagctgattttggctgtggcgggactctcacttgtcggattt
ttatacggcgctttgaagcttggctggtcagattcccaaatggctgcgacatttattttt
atttctgtccttgccggtttaataggcgggcttgcggcgaacgatattgccaaaaccttc
attacgggctgccaaagtcttgtatacggggcgctgattgtcgggatggcacgaagcatt
tccgttatccttgaaaatggaaagcttctcgatactgtcgtcaatgctttggcttcactt
ttggatggattcagcccgattgctggggcaatcggcatgtatatcgccagtgcgctgctt
cattttctcatctcttcaggttctggcgaagccgttgtatttattccaatcctggcgccg
ctcgctgatttgatgggaatcacgagacaggttgcggttgaagcggttatgcttggagaa
ggggtcgtcaactgtgtgaacccgacatccggcgttctcatggcggtgcttgccgccagc
ggtattccgtatgtcaagtggctgcggtttatggtgccgcttgctctgatttggttcttg
atcgggcttgtctttatcgtgatcggagtcatgatcaattgggggccgttttaa

DBGET integrated database retrieval system