KEGG   Bacillus subtilis subsp. subtilis 168: BSU03030Help
Entry
BSU03030          CDS       T00010                                 

Gene name
ycgB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF202 BatA OAD_gamma RAMP4
Motif
Other DBs
NCBI-GeneID: 938355
NCBI-ProteinID: NP_388185
Pasteur: BG12000
BSORF: BG12000
UniProt: P55909
Position
326888..327469
Genome map
AA seq 193 aa AA seqDB search
MNNLRNRLSGVNGKNKRVKEKEQKIWSEIGMIAGAFALLDVIIRGIMFEFPFKEWAASLV
FLFIIILYYCIRAAASGMLMPRIDTKEELQKRVKQQRIESIAVAFAVVVLTMYDRGIPHT
FFAWLKMILLFIVCGGVLFLLRYVIVKLAYRRAVKEEIKKKSSFLFGKRGKRSQFRAAFF
IGTLICIHSAKLF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctgcgtaatagactttcaggcgtgaatgggaaaaataagagagtaaaagaa
aaagaacaaaaaatctggtcggagattgggatgatagcgggagcatttgcgctgcttgat
gtgatcatccgcggcattatgtttgaatttccgtttaaagaatgggctgcaagccttgtg
tttttgttcatcattatcttatattactgcatcagggctgcggcatccggaatgctcatg
ccgagaatagacaccaaagaagaactgcaaaaacgggtgaagcagcagcgaatagaatca
attgcggtcgcctttgcggtagtggtgcttacgatgtacgacagggggattccccataca
ttcttcgcttggctgaaaatgattcttctttttatcgtctgcggcggcgttctgtttctg
cttcggtatgtgattgtgaagctggcttacagaagagcggtaaaagaagaaataaaaaag
aaatcatcttttttgtttggaaagcgagggaagcgttcacagtttcgggcagcttttttt
ataggaacattgatttgtattcactctgccaagttgttttga

DBGET integrated database retrieval system