KEGG   Bacillus subtilis subsp. subtilis 168: BSU03040Help
Entry
BSU03040          CDS       T00010                                 

Gene name
amyE
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU03040 (amyE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BSU03040 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM26 Alpha-amylase GATA-N hDGE_amylase Bac_A_amyl_C
Motif
Other DBs
NCBI-GeneID: 938356
NCBI-ProteinID: NP_388186
Pasteur: BG10473
BSORF: BG10473
UniProt: P00691
Structure
PDB: 

Position
327618..329597
Genome map
AA seq 659 aa AA seqDB search
MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAPSIKSGTILHAWNWSF
NTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQPTSYQIGNRYLGTEQE
FKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHIELPDDGSYGSQFWPNITN
TSAEFQYGEILQDSASRDAAYANYMDVTASNYGHSIRSALKNRNLGVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGNNQIFMNQRGSHGVVLANAGSS
SVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINARSVAVLYPDDIAKAPHVFLENYK
TGVTHSFNDQLTITLRADANTTKAVYQINNGPETAFKDGDQFTIGKGDPFGKTYTIMLKG
TNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQVNAYIYKHDGSRVIELTGSWPGKPM
TKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQNQPGFDYVLNGLYNDSGLSGSLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaaacgattcaaaacctctttactgccgttattcgctggatttttattgctg
tttcatttggttctggcaggaccggcggctgcgagtgctgaaacggcgaacaaatcgaat
gagcttacagcaccgtcgatcaaaagcggaaccattcttcatgcatggaattggtcgttc
aatacgttaaaacacaatatgaaggatattcatgatgcaggatatacagccattcagaca
tctccgattaaccaagtaaaggaagggaatcaaggagataaaagcatgtcgaactggtac
tggctgtatcagccgacatcgtatcaaattggcaaccgttacttaggtactgaacaagaa
tttaaagaaatgtgtgcagccgctgaagaatatggcataaaggtcattgttgacgcggtc
atcaatcataccaccagtgattatgccgcgatttccaatgaggttaagagtattccaaac
tggacacatggaaacacacaaattaaaaactggtctgatcgatgggatgtcacgcagaat
tcattgctcgggctgtatgactggaatacacaaaatacacaagtacagtcctatctgaaa
cggttcttagacagggcattgaatgacggggcagacggttttcgatttgatgccgccaaa
catatagagcttccagatgatggcagttacggcagtcaattttggccgaatatcacaaat
acatctgcagagttccaatacggagaaatcctgcaggatagtgcctccagagatgctgca
tatgcgaattatatggatgtgacagcgtctaactatgggcattccataaggtccgcttta
aagaatcgtaatctgggcgtgtcgaatatctcccactatgcatctgatgtgtctgcggac
aagctagtgacatgggtagagtcgcatgatacgtatgccaatgatgatgaagagtcgaca
tggatgagcgatgatgatatccgtttaggctgggcggtgatagcttctcgttcaggcagt
acgcctcttttcttttccagacctgagggaggcggaaatggtgtgaggttcccggggaaa
agccaaataggcgatcgcgggagtgctttatttgaagatcaggctatcactgcggtcaat
agatttcacaatgtgatggctggacagcctgaggaactctcgaacccgaatggaaacaac
cagatatttatgaatcagcgcggctcacatggcgttgtgctggcaaatgcaggttcatcc
tctgtctctatcaatacggcaacaaaattgcctgatggcaggtatgacaataaagctgga
gcgggttcatttcaagtgaacgatggtaaactgacaggcacgatcaatgccaggtctgta
gctgtgctttatcctgatgatattgcaaaagcgcctcatgttttccttgagaattacaaa
acaggtgtaacacattctttcaatgatcaactgacgattaccttgcgtgcagatgcgaat
acaacaaaagccgtttatcaaatcaataatggaccagagacggcgtttaaggatggagat
caattcacaatcggaaaaggagatccatttggcaaaacatacaccatcatgttaaaagga
acgaacagtgatggtgtaacgaggaccgagaaatacagttttgttaaaagagatccagcg
tcggccaaaaccatcggctatcaaaatccgaatcattggagccaggtaaatgcttatatc
tataaacatgatgggagccgagtaattgaattgaccggatcttggcctggaaaaccaatg
actaaaaatgcagacggaatttacacgctgacgctgcctgcggacacggatacaaccaac
gcaaaagtgatttttaataatggcagcgcccaagtgcccggtcagaatcagcctggcttt
gattacgtgctaaatggtttatataatgactcgggcttaagcggttctcttccccattga

DBGET integrated database retrieval system