KEGG   Bacillus subtilis subsp. subtilis 168: BSU03050
Entry
BSU03050          CDS       T00010                                 

Symbol
ldh
Name
(RefSeq) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00270  Cysteine and methionine metabolism
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU03050 (ldh)
   00620 Pyruvate metabolism
    BSU03050 (ldh)
   00640 Propanoate metabolism
    BSU03050 (ldh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU03050 (ldh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU03050 (ldh)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     BSU03050 (ldh)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   BSU03050 (ldh)
  Exosomal proteins of breast milk
   BSU03050 (ldh)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N 3HCDH_N F420_oxidored Sacchrp_dh_NADP Nit_Regul_Hom Shikimate_DH
Other DBs
NCBI-GeneID: 938348
NCBI-ProteinID: NP_388187
Pasteur: BG19003
BSORF: BG19003
UniProt: P13714 A0A6M4JIA2
Structure
Position
329774..330739
AA seq 321 aa
MMNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQ
PVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFL
VATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNVHAHIIGEHG
DTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAAYHIIEKKGATYYGVAMS
LARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQF
LHSAGVLKNILKPHFAEQKVN
NT seq 966 nt   +upstreamnt  +downstreamnt
atgatgaacaaacatgtaaataaagtagctttaatcggagcgggttttgttggaagcagt
tatgcatttgcgttaattaaccaaggaatcacagatgagcttgtggtcattgatgtaaat
aaagaaaaagcaatgggcgatgtgatggatttaaaccacggaaaggcgtttgcgccacaa
ccggtcaaaacatcttacggaacatatgaagactgcaaggatgctgatattgtctgcatt
tgcgccggagcaaaccaaaaacctggtgagacacgccttgaattagtagaaaagaacttg
aagattttcaaaggcatcgttagtgaagtcatggcgagcggatttgacggcattttctta
gtcgcgacaaatccggttgatatcctgacttacgcaacatggaaattcagcggcctgcca
aaagagcgggtgattggaagcggcacaacacttgattctgcgagattccgtttcatgctg
agcgaatactttggcgcagcgcctcaaaacgtacacgcgcatattatcggagagcacggc
gacacagagcttcctgtttggagccacgcgaatgtcggcggtgtgccggtcagtgaactc
gttgagaaaaacgatgcgtacaaacaagaggagctggaccaaattgtagatgatgtgaaa
aacgcagcttaccatatcattgagaaaaaaggcgcgacttattatggggttgcgatgagt
cttgctcgcattacaaaagccattcttcataatgaaaacagcatattaactgtcagcaca
tatttggacgggcaatacggtgcagatgacgtgtacatcggtgtgccggctgtcgtgaat
cgcggagggatcgcaggtatcactgagctgaacttaaatgagaaagaaaaagaacagttc
cttcacagcgccggcgtccttaaaaacattttaaaacctcattttgcagaacaaaaagtc
aactaa

DBGET integrated database retrieval system