KEGG   Bacillus subtilis subsp. subtilis 168: BSU03050Help
Entry
BSU03050          CDS       T00010                                 

Gene name
ldh
Definition
(RefSeq) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00270  Cysteine and methionine metabolism
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU03050 (ldh)
   00620 Pyruvate metabolism
    BSU03050 (ldh)
   00640 Propanoate metabolism
    BSU03050 (ldh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU03050 (ldh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU03050 (ldh)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     BSU03050 (ldh)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   BSU03050 (ldh)
  Exosomal proteins of breast milk
   BSU03050 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N 3HCDH_N Sacchrp_dh_NADP F420_oxidored GFO_IDH_MocA Nit_Regul_Hom Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 938348
NCBI-ProteinID: NP_388187
Pasteur: BG19003
BSORF: BG19003
UniProt: P13714
Structure
PDB: 

Position
329774..330739
Genome map
AA seq 321 aa AA seqDB search
MMNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQ
PVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFL
VATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNVHAHIIGEHG
DTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAAYHIIEKKGATYYGVAMS
LARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQF
LHSAGVLKNILKPHFAEQKVN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaaacatgtaaataaagtagctttaatcggagcgggttttgttggaagcagt
tatgcatttgcgttaattaaccaaggaatcacagatgagcttgtggtcattgatgtaaat
aaagaaaaagcaatgggcgatgtgatggatttaaaccacggaaaggcgtttgcgccacaa
ccggtcaaaacatcttacggaacatatgaagactgcaaggatgctgatattgtctgcatt
tgcgccggagcaaaccaaaaacctggtgagacacgccttgaattagtagaaaagaacttg
aagattttcaaaggcatcgttagtgaagtcatggcgagcggatttgacggcattttctta
gtcgcgacaaatccggttgatatcctgacttacgcaacatggaaattcagcggcctgcca
aaagagcgggtgattggaagcggcacaacacttgattctgcgagattccgtttcatgctg
agcgaatactttggcgcagcgcctcaaaacgtacacgcgcatattatcggagagcacggc
gacacagagcttcctgtttggagccacgcgaatgtcggcggtgtgccggtcagtgaactc
gttgagaaaaacgatgcgtacaaacaagaggagctggaccaaattgtagatgatgtgaaa
aacgcagcttaccatatcattgagaaaaaaggcgcgacttattatggggttgcgatgagt
cttgctcgcattacaaaagccattcttcataatgaaaacagcatattaactgtcagcaca
tatttggacgggcaatacggtgcagatgacgtgtacatcggtgtgccggctgtcgtgaat
cgcggagggatcgcaggtatcactgagctgaacttaaatgagaaagaaaaagaacagttc
cttcacagcgccggcgtccttaaaaacattttaaaacctcattttgcagaacaaaaagtc
aactaa

DBGET integrated database retrieval system