KEGG   Bacillus subtilis subsp. subtilis 168: BSU03060Help
Entry
BSU03060          CDS       T00010                                 

Gene name
lctP
Definition
(RefSeq) L-lactate permease
  KO
K03303  lactate permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03060 (lctP)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU03060 (lctP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactate_perm DUF2516
Motif
Other DBs
NCBI-GeneID: 938353
NCBI-ProteinID: NP_388188
Pasteur: BG12001
BSORF: BG12001
UniProt: P55910
Position
330771..332396
Genome map
AA seq 541 aa AA seqDB search
MWEQLYDPFGNEYVSALVALTPILFFLLALTVLKMKGILAAFLTLAVSFFVSVWAFHMPV
EKAISSVLLGIGSGLWPIGYIVLMAVWLYKIAVKTGKFTIIRSSIAGISPDQRLQLLLIG
FCFNAFLEGAAGFGVPIAISAALLVELGFKPLKAAALCLIANAASGAFGAIGIPVITGAQ
IGDLSALELSRTLMWTLPMISFLIPFLLVFLLDRMKGIKQTWPALLVVSGGYTAVQTLTM
AVLGPELANILAALFSMGGLALFLRKWQPKEIYREEGAGDAGEKKAYRAADIAKAWSPFY
ILTAAITIWSLPAFKALFQEGGLLYQSTLLFKMPFLHQQIMKMPPIAPSAMPLDAVFKVD
LLSATGTAILAAVIVTGLFSKKFSSRDAFASLKETGKELWVPIMTICFVMGFANLANFAG
LSSSIGLALAKTGDLFPFVSPVLGWIGVFITGSVVSNNALFGHLQVVTGAQIGAGSDLLL
AANTAGGVMAKLVSPQSIAIAAAAVGQTGKESKLFKRTVAYSLILLLIICIWTFILARLG
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagcagttgtatgatccgtttggaaacgagtatgtgagcgcacttgtggcgctc
actccgattctcttttttcttttggctttaactgttttgaaaatgaaaggcattcttgcg
gcatttcttaccctagccgtcagtttcttcgtctccgtttgggcatttcatatgccggtt
gaaaaagcgatttcttctgttttgttaggaatcgggagcgggctgtggcccattggctac
atcgtcctgatggcggtgtggctgtataaaatcgccgtgaaaaccgggaaatttaccatt
attcggtccagcattgccggcatttcgcctgaccaacgattacagctattattaattggt
ttttgttttaacgcgtttttagaaggcgcggccggttttggtgttccgattgcgattagt
gcggcgctgctcgtcgaacttggttttaaaccgttaaaagcggcggcgctctgcttgatt
gcaaacgctgcctccggagcctttggggcgattgggattcctgtcatcacaggggcgcag
attggtgatttgtctgctcttgagctgtctcggacattaatgtggacactgccgatgatc
tcatttttaataccattcctgcttgtattcttattagaccgaatgaaaggaatcaaacag
acatggcccgctcttctggttgtgagcggtgggtatacagcggttcagacactgacaatg
gcggtgctcgggccggaattagcaaacattttggcggccttattcagcatgggcgggctt
gccctcttcctccgcaaatggcagccgaaagagatttaccgcgaggaaggggccggcgat
gctggtgagaaaaaggcataccgtgccgctgacattgcgaaagcgtggtctcctttctac
attttaactgcggcgatcaccatctggagccttcctgccttcaaagcgcttttccaagaa
ggcgggctgttatatcaatcaacgctcctgttcaaaatgccttttctgcatcagcaaatt
atgaaaatgccgccgattgcgccatctgccatgccgttagatgcagtctttaaagttgat
ctgctgtcagcgactggtacagcgattttagcggcggtcatcgtgacagggctgttcagc
aaaaagttctcctctcgggatgcctttgcttccttgaaggagacgggaaaagagctgtgg
gtgccgattatgacgatctgcttcgtgatggggtttgccaatctggccaacttcgcaggg
ctcagctcttcaattgggttagcattggcgaaaacaggagacctgttcccgtttgtcagt
cctgttctcggctggattggcgtgttcatcaccggttctgttgtcagcaataatgctttg
ttcggccatttgcaggttgtcacgggagcgcagatcggtgcgggttcagatttgctgtta
gccgcaaatacggcgggcggtgtcatggcgaaacttgtttctcctcaatctatcgccatc
gctgccgcagcggtcggccaaacaggcaaggaatctaaactgtttaaaaggacagtggcg
tacagcctgattctgttattgatcatttgtatatggacgtttattcttgcaagattagga
gtgtaa

DBGET integrated database retrieval system