KEGG   Bacillus subtilis subsp. subtilis 168: BSU03070Help
Entry
BSU03070          CDS       T00010                                 

Gene name
mdr
Definition
(RefSeq) multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12 MFS_3 MFS_2 Virul_fac_BrkB DUF1985
Motif
Other DBs
NCBI-GeneID: 938345
NCBI-ProteinID: NP_388189
Pasteur: BG12002
BSORF: BG12002
UniProt: P96712
Position
complement(332441..333979)
Genome map
AA seq 512 aa AA seqDB search
MDTTTAKQASTKFVVLGLLLGILMSAMDNTIVATAMGNIVADLGSFDKFAWVTASYMVAV
MAGMPIYGKLSDMYGRKRFFLFGLIFFLIGSALCGIAQTMNQLIIFRAIQGIGGGALLPI
AFTIIFDLFPPEKRGKMSGMFGAVFGLSSVLGPLLGAIITDSISWHWVFYINVPIGALSL
FFIIRYYKESLEHRKQKIDWGGAITLVVSIVCLMFALELGGKTYDWNSIQIIGLFIVFAV
FFIAFFIVERKAEEPIISFWMFKNRLFATAQILAFLYGGTFIILAVFIPIFVQAVYGSSA
TSAGFILTPMMIGSVIGSMIGGIFQTKASFRNLMLISVIAFFIGMLLLSNMTPDTARVWL
TVFMMISGFGVGFNFSLLPAASMNDLEPRFRGTANSTNSFLRSFGMTLGVTIFGTVQTNV
FTNKLNDAFSGMKGSAGSGAAQNIGDPQEIFQAGTRSQIPDAILNRIIDAMSSSITYVFL
LALIPIVLAAVTILFMGKARVKTTAEMTKKAN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggacacaacaacagcaaaacaggcttccaccaaatttgtggtcctcggtctcctgctg
ggcatcttgatgtctgcaatggacaatacgattgttgccaccgcgatgggcaatatcgta
gccgatcttggaagcttcgataaatttgcctgggtgacggcatcctatatggtggcggtt
atggctggcatgccgatttacggcaagctttccgatatgtacggccgaaaacgttttttc
ctgtttggacttatttttttcttaatcggttctgctttatgcgggattgcccagacgatg
aatcagctgatcatcttccgggccattcaagggatcggaggcggcgcgctcctgccgatt
gcctttaccattatctttgatttgtttccgccggaaaaacgcggaaaaatgtccggcatg
ttcggtgctgtatttggattatccagtgttcttggtccgctcttaggcgcgatcattaca
gattcgatcagctggcactgggtgttttacatcaatgtgccgatcggcgcattgtcattg
tttttcattattcgctactacaaagaatctctggagcacagaaagcagaaaatagactgg
ggcggcgcgattaccttagtcgtatccattgtatgcctgatgttcgcccttgagcttggc
ggcaaaacatacgattggaactccattcagatcatcgggctgtttattgtattcgccgtt
ttcttcattgccttttttattgtggagagaaaagcagaagagccgattatttctttctgg
atgtttaagaaccgcttgtttgccacagcacagattctcgctttcctgtatggcggaaca
tttattattttagcggtatttattccgattttcgttcaggcggtctacggcagctcggcg
acaagcgcgggcttcattctgacgccgatgatgattggatcagtcatcggaagcatgatc
ggcgggatcttccaaacgaaggcaagcttccgcaatttgatgctgatatctgttatagct
ttctttatcggcatgctgcttctttccaatatgacgcctgacacagcacgggtatggctg
acagtctttatgatgatttcaggctttggtgtaggctttaacttctccctgctgccggcg
gcatcgatgaatgatcttgaacctcgctttcggggaacggcaaactctacaaattcattt
ttgcgatcatttggcatgaccttaggtgtcaccattttcggaacggtgcaaacaaacgta
ttcacaaacaagctgaatgacgccttcagcggtatgaaaggctcagcgggatcaggcgct
gcgcaaaatattggcgacccgcaggagatattccaagcgggaacacgttcccagattcct
gatgcgatcctgaatcgcattattgacgcgatgtcatcaagtatcacgtatgtctttttg
ctcgctttgattccaattgtcctcgcggcggttaccattttatttatgggaaaagccaga
gtgaaaacaacagccgaaatgacaaagaaagcaaattaa

DBGET integrated database retrieval system