KEGG   Bacillus subtilis subsp. subtilis 168: BSU03080
Entry
BSU03080          CDS       T00010                                 

Symbol
ycgE
Name
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR MarR_2 HTH_24 HTH_34 HTH_27 TrmB HTH_IclR HTH_AsnC-type Fe_dep_repress Penicillinase_R HTH_11 DprA_WH HTH_20 HTH_5 OTCace_N DUF4423
Other DBs
NCBI-GeneID: 938352
NCBI-ProteinID: NP_388190
Pasteur: BG12003
BSORF: BG12003
UniProt: O31472 A0A6M3Z780
Position
334092..334556
AA seq 154 aa
MSTRNSRSELEKTAVQLFRKLGTRTVLFHQAAAQALGLFPTDLKSADILNEAGPMTAGEL
GKKTGLSTGSVTALVDRLEKAGYVAREKDPNDRRRVVIVPLTASKKHIKDLFRPLSESTM
DLCREYTEEELELIFSFVGKAADIMEEELERLKQ
NT seq 465 nt   +upstreamnt  +downstreamnt
ttgtcaacaagaaattccagaagtgagttggaaaagactgctgttcagctttttcgaaaa
ctgggcacaagaacggttctgtttcatcaggcagccgctcaagctctcggtctgtttccc
accgatttgaaatcagctgacattttaaatgaagcagggccgatgacggccggagagctg
gggaaaaaaaccggcctcagcacgggttccgtcacggcgcttgttgaccggctggaaaaa
gcggggtatgtggctcgtgaaaaggacccgaacgatcgcaggagagtcgtaatcgtccct
ttgactgcttcgaaaaaacatataaaggatttgttccgtcctctgtctgagtcaacgatg
gatttgtgccgcgaatatacggaagaggagctggaactcattttcagttttgtaggcaaa
gctgccgatattatggaggaagagcttgaacgtctgaaacagtaa

DBGET integrated database retrieval system