KEGG   Bacillus subtilis subsp. subtilis 168: BSU03080Help
Entry
BSU03080          CDS       T00010                                 

Gene name
ycgE
Definition
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_24 HTH_27 HTH_34 TrmB HTH_IclR HTH_AsnC-type Fe_dep_repress HTH_20 Penicillinase_R HTH_11 DprA_WH HTH_5 OTCace_N RP-C DUF4423 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 938352
NCBI-ProteinID: NP_388190
Pasteur: BG12003
BSORF: BG12003
UniProt: O31472
Position
334092..334556
Genome map
AA seq 154 aa AA seqDB search
MSTRNSRSELEKTAVQLFRKLGTRTVLFHQAAAQALGLFPTDLKSADILNEAGPMTAGEL
GKKTGLSTGSVTALVDRLEKAGYVAREKDPNDRRRVVIVPLTASKKHIKDLFRPLSESTM
DLCREYTEEELELIFSFVGKAADIMEEELERLKQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaacaagaaattccagaagtgagttggaaaagactgctgttcagctttttcgaaaa
ctgggcacaagaacggttctgtttcatcaggcagccgctcaagctctcggtctgtttccc
accgatttgaaatcagctgacattttaaatgaagcagggccgatgacggccggagagctg
gggaaaaaaaccggcctcagcacgggttccgtcacggcgcttgttgaccggctggaaaaa
gcggggtatgtggctcgtgaaaaggacccgaacgatcgcaggagagtcgtaatcgtccct
ttgactgcttcgaaaaaacatataaaggatttgttccgtcctctgtctgagtcaacgatg
gatttgtgccgcgaatatacggaagaggagctggaactcattttcagttttgtaggcaaa
gctgccgatattatggaggaagagcttgaacgtctgaaacagtaa

DBGET integrated database retrieval system