KEGG   Bacillus subtilis subsp. subtilis 168: BSU03090Help
Entry
BSU03090          CDS       T00010                                 

Gene name
ycgF
Definition
(RefSeq) amino acid efflux protein YcgF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE Herpes_UL49_5 SfLAP
Motif
Other DBs
NCBI-GeneID: 938349
NCBI-ProteinID: NP_388191
Pasteur: BG12004
BSORF: BG12004
UniProt: P94381
Position
334630..335259
Genome map
AA seq 209 aa AA seqDB search
MNIFLSYIVLGLSLSAPVGPVNAAQIDKGIKNGFWHAWIFGLGAMTADGLYMLFIYFGLS
QFLTAPFVKTFLWLFGFFVLTYTGIETLKNVREPMDVRSSRGKPSYRKTFASGFLISLSN
PLSILFWLGIYGSILAKTAEAYNMNQLLIYSSGIMIGILIWDFCMAITASTFRNLLHEKL
LRGLTGIAGVSLLVFGFYFGYQGIKQLLG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatttttttgagctatattgtgctgggactgtccttgtctgcgcctgtggggcca
gtgaatgcggcgcaaatagacaaaggaattaaaaacggtttttggcatgcatggattttc
ggtttaggcgccatgacagcggatgggctgtacatgctttttatctatttcgggctgtcg
cagttcttgaccgctccatttgtgaaaacgtttttgtggctgttcggcttttttgtcctg
acctataccggaattgaaacgctgaaaaacgtcagagaaccgatggatgtgcgaagctcg
cgggggaaaccgtcatacaggaaaacattcgcatcgggttttctcatttcattgtcaaac
ccattgagcatccttttttggcttggaatttacggaagcattcttgcgaaaacagcagag
gcctacaatatgaatcagcttctaatctatagctccggcatcatgatcggcattttaatc
tgggatttctgcatggctatcacagccagtacgttcagaaacctgcttcatgaaaagcta
ttgagaggattgaccggaatcgccggtgtatccctccttgtgtttggcttttactttggt
tatcagggcatcaaacagttattgggctga

DBGET integrated database retrieval system