KEGG   Bacillus subtilis subsp. subtilis 168: BSU03100Help
Entry
BSU03100          CDS       T00010                                 

Gene name
ycgG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqcI_YcgG
Motif
Other DBs
NCBI-GeneID: 938350
NCBI-ProteinID: NP_388192
Pasteur: BG12005
BSORF: BG12005
UniProt: P94382
Position
335329..336090
Genome map
AA seq 253 aa AA seqDB search
MVNGIYTKSFLERIQEELPEWQRIAFELLAETLGDDADTFPCIPGRQAFLTDQLRIAFAG
DPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEHYSIEAYEELFWRFLNR
LSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFILCATPGHEARRSRSFPFFMVTFQPRWV
FDDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDNREWKQYFLRDDEKQVSKC
PFSYLKNMFNKMK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatgggatttacaccaaaagttttctggaacgtattcaggaagagcttcctgaa
tggcaaagaatcgcttttgagctgctggcagaaactctgggggacgacgcggatacattt
ccgtgcattcccggacgccaggcgtttctgactgatcagcttcggattgcttttgccgga
gatccgcgggaaaaccgcacagcggaggaactggctccgttgcttgcggagtacggcaag
atatcgcgggacacgggaaaatacgcatccctcgttgtgttgtttgatacaccggaagat
ttggcggagcattattcgattgaagcgtatgaagagctgttttggcgctttttaaataga
ctgagtcatcaagacgaaaaagaatggccggaagacattccggccgatcctgagcattat
aaatgggagttttgttttgacggcgagccgtatttcattctgtgcgctacaccggggcac
gaggcaagaagaagccggagctttcctttttttatggtcacgtttcagccaaggtgggtg
tttgatgacctaaatggatcaactgcatttggccgtaacatgagcaggctgatccgatct
cgtttagaggcctatgatcaggctccgattcacccgcaattaggctggtacggaggaaaa
gataatcgtgaatggaagcagtatttcctccgtgatgacgaaaaacaggtatcgaagtgc
ccgttttcttatttaaagaacatgttcaacaaaatgaaataa

DBGET integrated database retrieval system