KEGG   Bacillus subtilis subsp. subtilis 168: BSU03100
Entry
BSU03100          CDS       T00010                                 

Symbol
ycgG
Name
(RefSeq) hypothetical protein
  KO
K09190  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU03100 (ycgG)
SSDB
Motif
Pfam: YqcI_YcgG
Other DBs
NCBI-GeneID: 938350
NCBI-ProteinID: NP_388192
Pasteur: BG12005
BSORF: BG12005
UniProt: P94382 A0A6M3ZAD0
Position
335329..336090
AA seq 253 aa
MVNGIYTKSFLERIQEELPEWQRIAFELLAETLGDDADTFPCIPGRQAFLTDQLRIAFAG
DPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEHYSIEAYEELFWRFLNR
LSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFILCATPGHEARRSRSFPFFMVTFQPRWV
FDDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDNREWKQYFLRDDEKQVSKC
PFSYLKNMFNKMK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtgaatgggatttacaccaaaagttttctggaacgtattcaggaagagcttcctgaa
tggcaaagaatcgcttttgagctgctggcagaaactctgggggacgacgcggatacattt
ccgtgcattcccggacgccaggcgtttctgactgatcagcttcggattgcttttgccgga
gatccgcgggaaaaccgcacagcggaggaactggctccgttgcttgcggagtacggcaag
atatcgcgggacacgggaaaatacgcatccctcgttgtgttgtttgatacaccggaagat
ttggcggagcattattcgattgaagcgtatgaagagctgttttggcgctttttaaataga
ctgagtcatcaagacgaaaaagaatggccggaagacattccggccgatcctgagcattat
aaatgggagttttgttttgacggcgagccgtatttcattctgtgcgctacaccggggcac
gaggcaagaagaagccggagctttcctttttttatggtcacgtttcagccaaggtgggtg
tttgatgacctaaatggatcaactgcatttggccgtaacatgagcaggctgatccgatct
cgtttagaggcctatgatcaggctccgattcacccgcaattaggctggtacggaggaaaa
gataatcgtgaatggaagcagtatttcctccgtgatgacgaaaaacaggtatcgaagtgc
ccgttttcttatttaaagaacatgttcaacaaaatgaaataa

DBGET integrated database retrieval system