KEGG   Bacillus subtilis subsp. subtilis 168: BSU03110Help
Entry
BSU03110          CDS       T00010                                 

Gene name
ycgH
Definition
(RefSeq) transporter
  KO
K03293  amino acid transporter, AAT family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU03110 (ycgH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease MHC2-interact
Motif
Other DBs
NCBI-GeneID: 938347
NCBI-ProteinID: NP_388193
Pasteur: BG12006
BSORF: BG12006
UniProt: P94383
Position
complement(336092..337432)
Genome map
AA seq 446 aa AA seqDB search
MSQTKKDQPKGNLAWWQLSLIGVGCTIGTGFFLGSSIAIVKSGFSVLLSFLIAGIGTYFV
FEQLAKLSAKQPEKGSFCAYARKAFGKWAGFSNGWVYWTSEMLITGSQLTAISLFTKHWF
PQVPLWVFASIYAVLGLLIIFTGLSVFEKTENVLAVIKTAAIFMFIVIAILALCGILSGG
NHGIHVPNKTSEFFPYGAMGLWTGLIYAFYAFGGIEVMGLMAVHLKKPEEASKSGKLMLA
TLAIIYIISIGLALLLVPLHTFTEQDSPFITSLKGYNLEIILDIFNGIFIIAGFSTLVAS
LFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAGLVLSIILSLVLPKNIYEHMT
TAAGLMLLYTWLFILFSSKKLTDPEGMGKTQIYLAMVLIAAAVSGTLFEKSSRPGFFVSI
GFLVIIAIVTMIYQKKQGHKDRPASP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaaaaaaagaccagccaaaagggaatctggcttggtggcagctgtcactg
atcggagtcggctgcacgattggaacaggcttctttctcggttccagcatcgcaattgta
aaaagcggtttttccgttctcctttcatttctgatcgcagggatcggtacgtattttgtc
tttgaacagctcgccaagctatcggcgaagcagccggaaaagggctcgttttgtgcgtat
gcccgaaaagcattcggcaaatgggcaggcttcagcaacggctgggtgtactggacatca
gaaatgctgattaccggaagccagctgacagccatttcgctctttacgaagcattggttt
cctcaagtgccgctatgggtgtttgcctcaatctacgcagtacttgggctccttattatt
ttcaccggcctgtccgtctttgaaaaaacagaaaacgtgctggcagtcattaaaacagct
gctatttttatgtttattgtcattgccatcctggctttatgcggtatcctgtccggcgga
aatcatggcatacatgttccaaataagacgagtgagtttttcccatacggcgccatgggg
ctgtggacaggtttaatctacgcgttttacgcttttggcggaattgaggtcatggggctg
atggcggttcacttaaaaaaacctgaggaagcgtctaaatcagggaaactgatgctggcg
acgctggcgattatttatatcatttcaatcgggcttgctctgcttttggttccgttacac
acgtttactgaacaggacagtccgttcattacgtcattaaaaggatataaccttgagatc
atccttgatatatttaacgggattttcatcatcgcagggttctcgacccttgtcgcttcg
ctatttgcggttacgacattgctttgtacaatggctgatgacggcgacgcgccgaaatgc
tttactctaaaggaaggcaaaaaaatatgctggccggcacttgggctgacgtttgcgggg
cttgtcctctccattattttgtcgttagtgctgcctaaaaacatttatgagcatatgaca
acagctgcggggcttatgcttttatacacttggctgtttatcctgttctccagcaaaaag
ctgactgatcccgagggcatgggaaaaacgcaaatttatttagcgatggttctgattgct
gcagctgtgtccggtacattgtttgaaaaatcaagccggcccggttttttcgtcagcata
ggttttctcgtgattatcgccatcgttaccatgatctatcaaaaaaagcagggtcataaa
gatcgccctgccagtccttga

DBGET integrated database retrieval system