KEGG   Bacillus subtilis subsp. subtilis 168: BSU03120Help
Entry
BSU03120          CDS       T00010                                 

Gene name
ycgI
Definition
(RefSeq) hypothetical protein
  KO
K09967  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU03120 (ycgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1989 SH3_2
Motif
Other DBs
NCBI-GeneID: 938342
NCBI-ProteinID: NP_388194
Pasteur: BG12007
BSORF: BG12007
UniProt: O31473
Position
337562..338158
Genome map
AA seq 198 aa AA seqDB search
MTQQYIVEPKKGLGLKLKKGQILKVVDVEGQQVADFVAYHAKDFYEHLDQGATIDANHSI
HVKVNDHLYSNLYKPMLTLIEDTVGKHDLLLPACRPDMNRLLYGKQKDEFQDTCYDNMNR
ALEQFGVPKPHMHYPFAIFMNTVLDEKGNLSVETPLSNAGDYVRLRAEMDLIVAFSSCPI
EKGKCNGDSVTSIRVEVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaatatattgtggagccgaaaaaagggcttgggctgaagctgaaaaagggg
cagattttaaaggtggttgatgtagaagggcagcaggtggctgattttgtcgcataccat
gccaaggatttttatgaacaccttgatcagggagcgacgatagacgccaatcactccatt
catgtgaaggtcaacgaccatctctactccaacctgtataagccgatgttaaccctgatt
gaagatacggtcggcaagcatgatctgctgttgcccgcctgccgtcctgatatgaacagg
ctcttatatgggaagcaaaaggatgagtttcaggatacgtgctatgacaatatgaaccgt
gcgcttgagcagtttggcgtaccgaagccccacatgcattacccatttgcgatttttatg
aatactgtccttgatgagaaagggaatctgtctgtggaaacgccgctttcgaatgccgga
gattatgtaaggctcagggcggagatggatttaattgtcgcgttttcttcctgcccgatt
gaaaaagggaaatgcaatggcgacagtgtgacatccatacgggttgaagtcagctga

DBGET integrated database retrieval system