KEGG   Bacillus subtilis subsp. subtilis 168: BSU03130Help
Entry
BSU03130          CDS       T00010                                 

Gene name
nadE
Definition
(RefSeq) NH(3)-dependent NAD(+) synthetase
  KO
K01916  NAD+ synthase [EC:6.3.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
Module
bsu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU03130 (nadE)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.5  NAD+ synthase
     BSU03130 (nadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_synthase ATP_bind_3
Motif
Other DBs
NCBI-GeneID: 938339
NCBI-ProteinID: NP_388195
Pasteur: BG10694
BSORF: BG10694
UniProt: P08164
Structure
PDB: 

Position
338288..339106
Genome map
AA seq 272 aa AA seqDB search
MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQ
LAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQ
QETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLL
PLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKE
VSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcaggaaaagattatgcgtgagttacatgtgaagccctcaattgatccaaag
caagaaattgaggaccgagtcaattttttaaaacaatatgtaaagaaaaccggtgctaaa
ggctttgtattgggaatcagcgggggccaggattcaacacttgcgggaagactcgctcag
cttgcggtggagagcattcgcgaggagggcggagacgctcaatttatcgcggtccgtctt
ccgcatggcacacagcaggatgaagacgatgcccagcttgctttgaagtttattaagccg
gataaatcatggaagtttgatattaaatcgacagtcagcgctttttctgatcagtatcag
caggaaacaggcgatcagctgacggactttaataaaggaaacgtaaaagcaagaacaaga
atgatcgcgcaatacgcgatcggcggccaggaaggtcttcttgtgttaggaacagaccat
gctgctgaagcagtgactggtttctttacgaagtacggtgacggcggagcagacctcctg
ccgctgacaggcttgacgaagcgccagggaagaaccttgctgaaagagctgggtgcaccg
gaacgcttatacttaaaagaaccgactgccgatctgctcgacgaaaaaccgcagcagtcg
gatgaaacagagcttggcatttcctacgacgagattgacgattatctcgaaggaaaagaa
gtatcagcgaaagtatcagaagcgctggaaaaacgctacagcatgactgaacataaacgc
caggttccggcgtctatgtttgatgactggtggaaataa

DBGET integrated database retrieval system