KEGG   Bacillus subtilis subsp. subtilis 168: BSU03140Help
Entry
BSU03140          CDS       T00010                                 

Gene name
tmrB
Definition
(RefSeq) tunicamycin resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 Zeta_toxin APS_kinase
Motif
Other DBs
NCBI-GeneID: 938346
NCBI-ProteinID: NP_388196
Pasteur: BG10456
BSORF: BG10456
UniProt: P12921
Position
complement(339156..339749)
Genome map
AA seq 197 aa AA seqDB search
MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQEIAKDDFQSYPLWRA
FNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVHHFTLMASKETLLKRLR
TRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAENIAARAELPLDPDTRGSL
RRFADRLMVKLNHIRIK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcatttggataaacggggcattcggttcgggaaaaacacaaacagccttcgaactg
cacagaaggctgaacccatcttacgtgtatgatcccgagaaaatgggttttgcgctgcgc
tccatggtgccgcaggagatcgcaaaggacgattttcaaagctatcctttatggcgggcg
ttcaattacagtttgctagcttctctgacagatacataccgcggcatccttattgtgcct
atgacgattgtacaccctgaatacttcaatgagatcatcggcaggctcagacaggaaggc
aggatcgttcaccactttacactaatggcttcaaaggaaaccttgttaaaaaggctgcgc
accagagcagaaggaaaaaactcatgggccgccaaacaaattgaccgctgtgttgaagga
ttatcatcacccatttttgaggaccacattcaaacagacaacctgtcgattcaggatgtg
gcagagaacattgccgcgagagccgaactcccattagatcctgatacaagaggcagcctc
cgaaggttcgccgacagattaatggtaaagctgaatcatatccgcatcaaataa

DBGET integrated database retrieval system