KEGG   Bacillus subtilis subsp. subtilis 168: BSU03150Help
Entry
BSU03150          CDS       T00010                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU03150 (aroK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSU03150 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA AAA_18 AAA_14 AAA_16 AAA_22 GCR1_C PX TsaE AAA_33 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 938343
NCBI-ProteinID: NP_388197
Pasteur: BG10457
BSORF: BG10457
UniProt: P37944
Position
340025..340585
Genome map
AA seq 186 aa AA seqDB search
MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQIEKDFNMSIPEIFEK
KGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLENCLVLHLDLSWENWKQ
RADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNLSPEEVADYIVETLKIGW
DLYQPM
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaaacgagccatcccagtaagagaaagaaatatcgtcctgatcggattcatg
ggtgtaggaaaaacaacaatcggccaattggtcgctaaaaaattatatagagattttatt
gatattgaccagcagatcgaaaaggatttcaatatgtcaattcctgagatatttgagaaa
aagggagaagactttttccggaaaacggagaaggaatatattttagacatctgccatcat
aaacgattcaaaatcgtatctctgggcgggggatcttttaaacaagaagaaatcagaaat
tgctgtctggaaaactgtctcgtgcttcatctggacctgtcatgggagaactggaagcag
cgcgcggatttattgatcgaaagccgccctgtactgcataaccgttcaatggatgaaatg
gaacagctgtttaacgaaagaaaagtcatttatgacaagcacaattcaaaagtggcaaca
gacaacctttccccggaagaggttgccgattacattgttgagacattaaaaattggctgg
gatctttatcagccgatgtaa

DBGET integrated database retrieval system