KEGG   Bacillus subtilis subsp. subtilis 168: BSU03150
Entry
BSU03150          CDS       T00010                                 

Symbol
aroK
Name
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU03150 (aroK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSU03150 (aroK)
SSDB
Motif
Pfam: SKI AAA AAA_18 AAA_14 AAA_16 AAA_22 GCR1_C TsaE AAA_33
Other DBs
NCBI-GeneID: 938343
NCBI-ProteinID: NP_388197
Pasteur: BG10457
BSORF: BG10457
UniProt: P37944 A0A6M3Z7Q1
Position
340025..340585
AA seq 186 aa
MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQIEKDFNMSIPEIFEK
KGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLENCLVLHLDLSWENWKQ
RADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNLSPEEVADYIVETLKIGW
DLYQPM
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaacgctaaacgagccatcccagtaagagaaagaaatatcgtcctgatcggattcatg
ggtgtaggaaaaacaacaatcggccaattggtcgctaaaaaattatatagagattttatt
gatattgaccagcagatcgaaaaggatttcaatatgtcaattcctgagatatttgagaaa
aagggagaagactttttccggaaaacggagaaggaatatattttagacatctgccatcat
aaacgattcaaaatcgtatctctgggcgggggatcttttaaacaagaagaaatcagaaat
tgctgtctggaaaactgtctcgtgcttcatctggacctgtcatgggagaactggaagcag
cgcgcggatttattgatcgaaagccgccctgtactgcataaccgttcaatggatgaaatg
gaacagctgtttaacgaaagaaaagtcatttatgacaagcacaattcaaaagtggcaaca
gacaacctttccccggaagaggttgccgattacattgttgagacattaaaaattggctgg
gatctttatcagccgatgtaa

DBGET integrated database retrieval system