KEGG   Bacillus subtilis subsp. subtilis 168: BSU03160Help
Entry
BSU03160          CDS       T00010                                 

Gene name
ycgJ
Definition
(RefSeq) methyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_31 Methyltransf_25 Ubie_methyltran Methyltransf_23 Methyltransf_12 MTS PCMT Methyltransf_29 Methyltransf_32 Methyltransf_4 PrmA GidB Methyltransf_2 DREV NodS Methyltransf_3 UPF0020 CMAS Methyltransf_24
Motif
Other DBs
NCBI-GeneID: 938344
NCBI-ProteinID: NP_388198
Pasteur: BG12008
BSORF: BG12008
UniProt: O31474
Structure
PDB: 

Position
complement(340613..341374)
Genome map
AA seq 253 aa AA seqDB search
MTNETPFSKNAEMYRDEKVFAEGEDLGLMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQ
ECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPDDSFDIITCRYAAHHFSDVR
KAVREVARVLKQDGRFLLVDHYAPEDPVLDEFVNHLNRLRDPSHVRESSLSEWQAMFSAN
QLAYQDIQKWNLPIQYDSWIKRGGTPADREKQIITHLNHASDEARDTFCITLNQNGQPIS
FCLKAILIQGIKR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaacaccgttttctaaaaacgccgagatgtatcgggatgaaaaggtattt
gccgagggggaagatttggggttgatgatcaaaacagcggaatgccgggcagagcatcga
gtgctggatataggagcgggcgccggccatacggcgctggcattttctccttatgtacag
gagtgcatcggtgttgatgcaacgaaagagatggttgaggttgcgtcctccttcgcgcaa
gaaaaaggagttgaaaacgtacgctttcagcaaggaacggcagagtcactccccttcccc
gacgattcatttgacatcatcacctgccgatacgcagcccaccatttttcagatgtccgc
aaagctgtcagagaggttgcacgcgtactaaaacaggacggacgttttctcttagttgat
cattacgcgcctgaagatcccgttcttgatgagtttgtcaatcatttgaaccggcttcga
gacccttcccatgttcgtgaaagctcattatcagaatggcaggcgatgttcagcgccaat
caactggcctatcaagacatccaaaagtggaacttgccgattcaatacgatagctggatc
aaacgaggcggaacccccgctgaccgagaaaaacaaatcattacccacttgaatcacgca
tcagacgaagcacgcgacacgttctgtattacattgaaccaaaacggacagcccatctcc
ttttgtttaaaagcgattttgatacaagggataaaacgataa

DBGET integrated database retrieval system